Genome KpKP13

Protein target profile

hypothetical protein

Accession: KP13_02183

Gene: AHE42752.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GSX5
Length 167
Pocket druggability (P2Rank · AlphaFold DB model) 0.025
Direct ligand evidence 0 8 total records
Functional annotation 0 EC 2 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
90.3 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.025
Structure A0A0H3GSX5
Pocket Pocket 1
Druggability (FPocket) 0.282
Structure A0A0H3GSX5
Pocket Pocket 4
ColabFold model
P2Rank 0.034 · Pocket 1
FPocket 0.385 · Pocket 1
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 60 / 4744 genomes with a hit
Prevalence 1.3%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MASKIRRWLRELAVWLLIGAAVSLAVDYFRQPALPQNVSATSLQTLDGRTLDLHAMSQQKPLLLYVWATWCGVCRYTTPSVASLAADGGNVLTVALRSGDNVALEKWLTRKKLTLPTVNDPSGQLARQWDIQVTPTLVVISQGEVKSVTTGWTSSWGMRLRLWLASW

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Subcellular localization

Localization
Unknown

Gene Ontology (GO)

2
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0016209 Inhibition of the reactions brought about by dioxygen (O2) or peroxides. Usually the antioxidant is effective because it can itself be more easily oxidized than the substance protected. The term is often applied to components that can trap free radicals, thereby breaking the chain reaction that normally leads to extensive biological damage.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
7 156 SUPERFAMILY SSF52833 Thioredoxin-like
7 156 InterPro IPR036249 Thioredoxin-like superfamily
42 163 CDD cd03011 TlpA_like_ScsD_MtbDsbE
32 150 ProSiteProfiles PS51352 Thioredoxin domain profile.
32 150 InterPro IPR013766 Thioredoxin domain
12 20 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 25 Phobius SIGNAL_PEPTIDE Signal peptide region
21 25 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
40 144 Pfam PF00578 AhpC/TSA family
40 144 InterPro IPR000866 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant
1 11 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
42 158 PANTHER PTHR42852 THIOL:DISULFIDE INTERCHANGE PROTEIN DSBE
12 29 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
26 167 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
29 158 Gene3D G3DSA:3.40.30.10 Glutaredoxin

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.025
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #4
0.282
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GSX5
AlphaFold DB full sequence Viewing
ColabFold KP13_02183
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

8 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 4 records from similar proteins
Structural ligands 4 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 4 similarity-based ZINC candidates
Best available ligand signal
C6W PDB via homolog 301.3 Da · LogP 1.83 · TPSA 58.6 Open detail RCSB PDB
HED PDB via homolog Detail RCSB PDB
MLI PDB via homolog Detail RCSB PDB
PX5 PDB via homolog Detail RCSB PDB
ZINC9111 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
C6W RCSB PDB A0A0H2UPR5 301.3 Da LogP 1.83 TPSA 58.6 ✓ Ro5 ✓ Clean C[N+](C)(C)CCOP(=O)([O-])OCCCc1ccccc1
HED RCSB PDB A0A0H2UPR5 154.3 Da LogP 0.35 TPSA 40.5 ✓ Ro5 ✓ Clean C(CSSCCO)O
MLI RCSB PDB A0A0H2UPR5 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
PX5 RCSB PDB P9WG67 243.3 Da LogP 2.18 TPSA 50.2 ✓ Ro5 ✓ Clean c1ccc2c(c1)nc(s2)C3(C=CC(=O)C=C3)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.