Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 37.363 Lower values reduce human off-target concern.
- Human E-value
- 2.05e-45
- Gut microbiome similarity
- 2.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Localization
- Localization
- CytoplasmicMembrane
Structure confidence
- ColabFold pLDDT
- 88.2 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Chemistry
Sequence
Primary amino-acid sequence viewer.
MTSISNDSTLSPRTQRDTRRMNWFVSIAAAVAGLLFGLDIGVISGALPFITDHFTLSSQLQEWVVSSMMLGAAIGALFNGWLSFRLGRKYSLMAGAVLFVAGSIGSAFAASVEVLLVARVVLGVAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVLAFLSDTAFSYSGNWRAMLGVLALPAVILIILVVFLPNSPRWLAEKGRHIEAEEVLRMLRDTSEKARDELNEIRESLKLKQGGWALFKVNRNVRRAVFLGMLLQAMQQFTGMNIIMYYAPRIFKMAGFTTTEQQMIATLVVGLTFMFATFIAVFTVDKAGRKPALKIGFSVMALGTLVLGYCLMQFDNGTASSGLSWLSVGMTMMCIAGYAMSAAPVVWILCSEIQPLKCRDFGITCSTTTNWVSNMIIGATFLTLLDAIGAAGTFWLYTALNVAFIGITFWLIPETKNVTLEHIERNLMAGEKLRNIGNR
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
6- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
- GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0015149 Enables the transfer of a hexose sugar, a monosaccharide with 6 carbon atoms, from one side of a membrane to the other.
- GO:0015293 Enables the active transport of a solute across a membrane by a mechanism whereby two or more species are transported together in the same direction in a tightly coupled process not directly linked to a form of energy other than chemiosmotic energy.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 314 | 330 | ProSitePatterns | PS00216 | Sugar transport proteins signature 1. |
| 314 | 330 | InterPro | IPR005829 | Sugar transporter, conserved site |
| 21 | 43 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 405 | 422 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 329 | 348 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 447 | 473 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 325 | 347 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 121 | 146 | ProSitePatterns | PS00217 | Sugar transport proteins signature 2. |
| 121 | 146 | InterPro | IPR005829 | Sugar transporter, conserved site |
| 138 | 148 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 21 | 43 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 14 | 462 | Gene3D | G3DSA:1.20.1250.20 | MFS general substrate transporter like domains |
| 14 | 462 | InterPro | IPR036259 | MFS transporter superfamily |
| 111 | 115 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 150 | 167 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 8 | 457 | NCBIfam | TIGR00879 | sugar porter family MFS transporter |
| 8 | 457 | InterPro | IPR003663 | Sugar/inositol transporter |
| 385 | 404 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 63 | 84 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 91 | 110 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 360 | 384 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 44 | 62 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 63 | 83 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 349 | 359 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 20 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 259 | 281 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 12 | 458 | SUPERFAMILY | SSF103473 | MFS general substrate transporter |
| 12 | 458 | InterPro | IPR036259 | MFS transporter superfamily |
| 85 | 90 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 428 | 446 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 149 | 167 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 423 | 427 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 28 | 448 | CDD | cd17315 | MFS_GLUT_like |
| 90 | 112 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 116 | 138 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 18 | 464 | PANTHER | PTHR48020 | PROTON MYO-INOSITOL COTRANSPORTER |
| 282 | 296 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 297 | 317 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 362 | 384 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 258 | 281 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 15 | 463 | FunFam | G3DSA:1.20.1250.20:FF:000008 | Galactose-proton symporter (Galactose transporter) |
| 211 | 242 | Coils | Coil | Coil |
| 318 | 328 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 199 | 257 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 179 | 198 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 177 | 199 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 428 | 447 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 26 | 460 | Pfam | PF00083 | Sugar (and other) transporter |
| 26 | 460 | InterPro | IPR005828 | Major facilitator, sugar transporter-like |
| 362 | 383 | PRINTS | PR00171 | Sugar transporter signature |
| 362 | 383 | InterPro | IPR003663 | Sugar/inositol transporter |
| 269 | 279 | PRINTS | PR00171 | Sugar transporter signature |
| 269 | 279 | InterPro | IPR003663 | Sugar/inositol transporter |
| 33 | 43 | PRINTS | PR00171 | Sugar transporter signature |
| 33 | 43 | InterPro | IPR003663 | Sugar/inositol transporter |
| 116 | 135 | PRINTS | PR00171 | Sugar transporter signature |
| 116 | 135 | InterPro | IPR003663 | Sugar/inositol transporter |
| 385 | 397 | PRINTS | PR00171 | Sugar transporter signature |
| 385 | 397 | InterPro | IPR003663 | Sugar/inositol transporter |
| 168 | 178 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 405 | 424 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 296 | 318 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 116 | 137 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 25 | 450 | ProSiteProfiles | PS50850 | Major facilitator superfamily (MFS) profile. |
| 25 | 450 | InterPro | IPR020846 | Major facilitator superfamily domain |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GUX1
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_15122
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 37X RCSB PDB | P11169 | 568.7 Da LogP -0.45 TPSA 198.8 | 3 viol. | ✓ Clean |
CCCCCCC(CCCCCC)(CO[C@@H]1[C@H]([C@@H]([C@H]([C@…
|
|
| F00 RCSB PDB | P11169 | 332.4 Da LogP 1.11 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
C=CCCCCCCCCCO[C@H]1[C@@H]([C@H](O[C@@H]([C@@H]1…
|
|
| OLC RCSB PDB | P11169 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](CO)O
|
|
| Y01 RCSB PDB | P11169 | 486.7 Da LogP 7.80 TPSA 63.6 | 1 viol. | ✓ Clean |
CC(C)CCC[C@@H](C)[C@H]1CC[C@@H]2[C@@]1(CC[C@H]3…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL5661847 ChEMBL | P11166 | 9.00 ~1.0 nM | 499.5 Da LogP 4.86 TPSA 102.9 | ✓ Ro5 | ✓ Clean |
CCc1ccc(Cn2nc(C(F)(F)F)c(NC(=O)c3cc(C(N)=O)nc4c…
|
| CHEMBL4448899 ChEMBL | P11166 | 8.70 ~2.0 nM | 496.4 Da LogP 4.17 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(F)(F)F…
|
| CHEMBL5661896 ChEMBL | P11166 | 8.70 ~2.0 nM | 529.3 Da LogP 5.40 TPSA 96.5 | 2 viol. | ✓ Clean |
Cc1nn(Cc2ccc(C#N)cn2)c(C)c1NC(=O)c1cc(C(F)(F)F)…
|
| CHEMBL5661910 ChEMBL | P11166 | 8.70 ~2.0 nM | 514.4 Da LogP 4.31 TPSA 126.7 | 1 viol. | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)c(F)cc23)c(C(F)(…
|
| CHEMBL5661878 ChEMBL | P11166 | 8.52 ~3.0 nM | 496.4 Da LogP 4.17 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(F)(F)F…
|
| CHEMBL5661885 ChEMBL | P11166 | 8.52 ~3.0 nM | 546.3 Da LogP 6.14 TPSA 83.6 | 2 viol. | ✓ Clean |
Cc1nn(Cc2ccc(C#N)c(F)c2)c(C)c1NC(=O)c1cc(C(F)(F…
|
| CHEMBL5661888 ChEMBL | P11166 | 8.52 ~3.0 nM | 512.9 Da LogP 4.68 TPSA 126.7 | 1 viol. | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3c(Cl)cccc23)c(C(F)(F)…
|
| CHEMBL5661828 ChEMBL | P11166 | 8.40 ~4.0 nM | 518.5 Da LogP 6.05 TPSA 96.5 | 2 viol. | ✓ Clean |
Cc1c(NC(=O)c2cc(-c3nccs3)nc3ccccc23)c(C(F)(F)F)…
|
| CHEMBL5661865 ChEMBL | P11166 | 8.40 ~4.0 nM | 528.3 Da LogP 6.00 TPSA 83.6 | 2 viol. | ✓ Clean |
Cc1nn(Cc2ccc(C#N)cc2)c(C)c1NC(=O)c1cc(C(F)(F)F)…
|
| CHEMBL5661934 ChEMBL | P11166 | 8.40 ~4.0 nM | 497.4 Da LogP 3.56 TPSA 139.6 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(F)(F)F…
|
| CHEMBL4092369 ChEMBL | P11166 | 8.31 ~4.9 nM | 577.7 Da LogP 3.28 TPSA 151.0 | 1 viol. | ✓ Clean |
C/C=C(\C)[C@H](O[C@@H]1O[C@H](CO)[C@@H](O)[C@H]…
|
| CHEMBL5661852 ChEMBL | P11166 | 8.30 ~5.0 nM | 498.4 Da LogP 2.96 TPSA 152.5 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(F)(F)F…
|
| CHEMBL5661908 ChEMBL | P11166 | 8.30 ~5.0 nM | 555.4 Da LogP 5.20 TPSA 112.1 | 2 viol. | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(F)(F)F…
|
| CHEMBL5661921 ChEMBL | P11166 | 8.30 ~5.0 nM | 496.4 Da LogP 4.17 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3c(F)cccc23)c(C(F)(F)F…
|
| CHEMBL5661901 ChEMBL | P11166 | 8.22 ~6.0 nM | 478.4 Da LogP 4.03 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3ccccc23)c(C(F)(F)F)nn…
|
| CHEMBL5661932 ChEMBL | P11166 | 8.22 ~6.0 nM | 521.3 Da LogP 6.27 TPSA 59.8 | 2 viol. | ✓ Clean |
Cc1nn(Cc2ccc(F)cc2)c(C)c1NC(=O)c1cc(C(F)(F)F)nc…
|
| CHEMBL5661884 ChEMBL | P11166 | 8.15 ~7.1 nM | 492.5 Da LogP 4.34 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
Cc1ccc2nc(C(N)=O)cc(C(=O)Nc3c(C(F)(F)F)nn(Cc4cc…
|
| CHEMBL5661892 ChEMBL | P11166 | 8.15 ~7.1 nM | 485.4 Da LogP 4.61 TPSA 102.9 | ✓ Ro5 | ✓ Clean |
Cc1ccccc1Cn1nc(C(F)(F)F)c(NC(=O)c2cc(C(N)=O)nc3…
|
| CHEMBL5661918 ChEMBL | P11166 | 8.15 ~7.1 nM | 428.4 Da LogP 3.15 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)cnn1Cc1ccc…
|
| CHEMBL5661930 ChEMBL | P11166 | 8.15 ~7.1 nM | 516.5 Da LogP 4.73 TPSA 114.3 | 1 viol. | ✓ Clean |
Cc1c(NC(=O)c2cc(-c3ncnn3C)nc3ccccc23)c(C(F)(F)F…
|
| CHEMBL5661940 ChEMBL | P11166 | 8.15 ~7.1 nM | 470.5 Da LogP 4.27 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(C)C)nn…
|
| CHEMBL5661915 ChEMBL | P11166 | 8.10 ~7.9 nM | 492.5 Da LogP 4.34 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
Cc1ccc2c(C(=O)Nc3c(C(F)(F)F)nn(Cc4ccc(C#N)cc4)c…
|
| CHEMBL5661919 ChEMBL | P11166 | 8.10 ~7.9 nM | 546.3 Da LogP 6.14 TPSA 83.6 | 2 viol. | ✓ Clean |
Cc1nn(Cc2ccc(C#N)cc2F)c(C)c1NC(=O)c1cc(C(F)(F)F…
|
| CHEMBL5661850 ChEMBL | P11166 | 8.05 ~8.9 nM | 539.4 Da LogP 5.32 TPSA 102.9 | 2 viol. | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(F)(F)F…
|
| CHEMBL3780239 ChEMBL | P11169 | 8.00 ~10.0 nM | 404.4 Da LogP 3.29 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1ccc(F)cc1N1CCN(c2ncnc3c2cnn3-c2ccccc2)CC1
|
| CHEMBL5661933 ChEMBL | P11166 | 8.00 ~10.0 nM | 479.4 Da LogP 3.42 TPSA 139.6 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cnccc23)c(C(F)(F)F)nn…
|
| CHEMBL5661907 ChEMBL | P11166 | 7.96 ~11.0 nM | 485.4 Da LogP 4.61 TPSA 102.9 | ✓ Ro5 | ✓ Clean |
Cc1cccc(Cn2nc(C(F)(F)F)c(NC(=O)c3cc(C(N)=O)nc4c…
|
| CHEMBL4645691 ChEMBL | P11169 | 7.92 ~12.0 nM | 498.6 Da LogP 4.99 TPSA 114.1 | ✓ Ro5 | ✓ Clean |
CCC(C)(C)NC(=O)COc1cccc(-c2nc3c(c(Nc4ccc(-c5cn[…
|
| CHEMBL5661913 ChEMBL | P11166 | 7.92 ~12.0 nM | 502.5 Da LogP 4.23 TPSA 126.7 | 1 viol. | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(F)(F)F…
|
| CHEMBL5661874 ChEMBL | P11166 | 7.85 ~14.1 nM | 479.4 Da LogP 3.42 TPSA 139.6 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3ccncc23)c(C(F)(F)F)nn…
|
| CHEMBL5661939 ChEMBL | P11166 | 7.75 ~17.8 nM | 492.5 Da LogP 4.34 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
Cc1cccc2nc(C(N)=O)cc(C(=O)Nc3c(C(F)(F)F)nn(Cc4c…
|
| CHEMBL5661911 ChEMBL | P11166 | 7.72 ~19.1 nM | 482.4 Da LogP 3.86 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
N#Cc1ccc(Cn2cc(NC(=O)c3cc(C(N)=O)nc4cc(F)ccc34)…
|
| CHEMBL5661922 ChEMBL | P11166 | 7.70 ~20.0 nM | 575.3 Da LogP 6.98 TPSA 59.8 | 2 viol. | ✓ Clean |
Cc1c(NC(=O)c2cc(C(F)(F)F)nc3ccc(Br)cc23)c(C(F)(…
|
| CHEMBL3781913 ChEMBL | P11168 | 7.68 ~20.9 nM | 400.5 Da LogP 3.54 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCCN(c2ncnc3c2cnn3-c2ccccc2)CC1
|
| CHEMBL5661833 ChEMBL | P11166 | 7.62 ~24.0 nM | 508.5 Da LogP 4.04 TPSA 135.9 | 1 viol. | ✓ Clean |
COc1ccc2c(C(=O)Nc3c(C(F)(F)F)nn(Cc4ccc(C#N)cc4)…
|
| CHEMBL5661929 ChEMBL | P11166 | 7.60 ~25.1 nM | 496.4 Da LogP 4.17 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(F)(F)F…
|
| CHEMBL4289139 ChEMBL | P11166 | 7.59 ~25.7 nM | 550.0 Da LogP 6.29 TPSA 64.6 | 2 viol. | ✓ Clean |
N#Cc1ccccc1-c1ccc2nc(-c3ccc(Cl)cc3)c(CN3CCN(C(=…
|
| CHEMBL4647311 ChEMBL | P11169 | 7.58 ~26.3 nM | 498.6 Da LogP 4.64 TPSA 114.1 | ✓ Ro5 | ✓ Clean |
CC(C)(C)NC(=O)COc1cccc(-c2nc3c(c(Nc4ccc(-c5cn[n…
|
| CHEMBL5661834 ChEMBL | P11166 | 7.58 ~26.3 nM | 498.4 Da LogP 2.96 TPSA 152.5 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(F)(F)F…
|
| CHEMBL5661890 ChEMBL | P11166 | 7.50 ~31.6 nM | 497.4 Da LogP 3.56 TPSA 139.6 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(F)(F)F…
|
| CHEMBL4634839 ChEMBL | P11169 | 7.48 ~33.1 nM | 512.6 Da LogP 5.03 TPSA 114.1 | 2 viol. | ✓ Clean |
CCC(CC)NC(=O)COc1cccc(-c2nc3c(c(Nc4ccc(-c5cn[nH…
|
| CHEMBL4445670 ChEMBL | P11166 | 7.46 ~34.7 nM | 515.5 Da LogP 3.28 TPSA 100.7 | 1 viol. | ✓ Clean |
CN1CCN(c2cnc3c(C4CCN(C(=O)c5ccc(OC(F)(F)F)cc5N)…
|
| CHEMBL5661838 ChEMBL | P11169 | 7.46 ~34.7 nM | 428.4 Da LogP 3.15 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
Cc1nn(Cc2ccc(C#N)cc2)cc1NC(=O)c1cc(C(N)=O)nc2cc…
|
| CHEMBL5661859 ChEMBL | P11166 | 7.46 ~34.7 nM | 485.5 Da LogP 3.49 TPSA 139.6 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3scnc23)c(C(F)(F)F)nn1…
|
| CHEMBL592105 ChEMBL | P11166 | 7.42 ~38.0 nM | 389.5 Da LogP 4.17 TPSA 30.0 | ✓ Ro5 | Alert |
CN(C)c1ccc(C(O)(c2ccc(N(C)C)cc2)c2ccc(N(C)C)cc2…
|
| CHEMBL3780972 ChEMBL | P11169 | 7.40 ~39.8 nM | 404.4 Da LogP 3.29 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1cc(F)ccc1N1CCN(c2ncnc3c2cnn3-c2ccccc2)CC1
|
| CHEMBL3781548 ChEMBL | P11169 | 7.40 ~39.8 nM | 404.4 Da LogP 3.29 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCN(c2ncnc3c2cnn3-c2ccccc2F)CC1
|
| CHEMBL5661942 ChEMBL | P11166 | 7.37 ~42.7 nM | 535.3 Da LogP 6.83 TPSA 59.8 | 2 viol. | ✓ Clean |
Cc1nn(C(C)c2ccc(F)cc2)c(C)c1NC(=O)c1cc(C(F)(F)F…
|
| CHEMBL3781151 ChEMBL | P11169 | 7.34 ~45.7 nM | 404.4 Da LogP 3.29 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCN(c2ncnc3c2cnn3-c2ccc(F)cc2)CC1
|
| CHEMBL4634011 ChEMBL | P11169 | 7.33 ~46.8 nM | 496.6 Da LogP 4.75 TPSA 114.1 | ✓ Ro5 | ✓ Clean |
O=C(COc1cccc(-c2nc3c(c(Nc4ccc(-c5cn[nH]c5)cc4)n…
|
| CHEMBL3780144 ChEMBL | P11169 | 7.30 ~50.1 nM | 411.5 Da LogP 3.02 TPSA 83.1 | ✓ Ro5 | ✓ Clean |
COc1ccc(C#N)cc1N1CCN(c2ncnc3c2cnn3-c2ccccc2)CC1
|
| CHEMBL4633651 ChEMBL | P11169 | 7.24 ~57.5 nM | 497.6 Da LogP 4.22 TPSA 116.9 | ✓ Ro5 | ✓ Clean |
CC(C)(C)NC(=O)COc1cccc(-c2nc3c(c(Nc4ccc(-c5cn[n…
|
| CHEMBL5661925 ChEMBL | P11166 | 7.23 ~58.9 nM | 511.3 Da LogP 5.51 TPSA 69.0 | 2 viol. | ✓ Clean |
Cc1nn(CC2CCOCC2)c(C)c1NC(=O)c1cc(C(F)(F)F)nc2cc…
|
| CHEMBL3781149 ChEMBL | P11168 | 7.22 ~60.3 nM | 372.4 Da LogP 2.85 TPSA 70.3 | ✓ Ro5 | ✓ Clean |
Oc1ccccc1N1CCN(c2ncnc3c2cnn3-c2ccccc2)CC1
|
| CHEMBL547470 ChEMBL | P11166 | 7.20 ~63.1 nM | 478.6 Da LogP 5.01 TPSA 52.2 | 1 viol. | ✓ Clean |
CCC1=C(CC2NCCc3cc(OC)c(OC)cc32)CC2c3cc(OC)c(OC)…
|
| CHEMBL3780785 ChEMBL | P11169 | 7.19 ~64.6 nM | 386.5 Da LogP 3.15 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCN(c2ncnc3c2ncn3-c2ccccc2)CC1
|
| CHEMBL4638234 ChEMBL | P11169 | 7.17 ~67.6 nM | 482.5 Da LogP 4.36 TPSA 114.1 | ✓ Ro5 | ✓ Clean |
O=C(COc1cccc(-c2nc3c(c(Nc4ccc(-c5cn[nH]c5)cc4)n…
|
| CHEMBL5661895 ChEMBL | P11166 | 7.17 ~67.6 nM | 503.4 Da LogP 3.63 TPSA 139.6 | 1 viol. | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(F)(F)F…
|
| CHEMBL5661862 ChEMBL | P11166 | 7.13 ~74.1 nM | 512.5 Da LogP 5.99 TPSA 96.5 | 2 viol. | ✓ Clean |
Cc1c(NC(=O)c2cc(-c3cccnc3)nc3ccccc23)c(C(F)(F)F…
|
| CHEMBL5661920 ChEMBL | P11166 | 7.11 ~77.6 nM | 498.4 Da LogP 2.96 TPSA 152.5 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(F)(F)F…
|
| CHEMBL3781535 ChEMBL | P11166 | 7.10 ~79.4 nM | 405.4 Da LogP 2.68 TPSA 72.2 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCN(c2ncnc3c2cnn3-c2ncccc2F)CC1
|
| CHEMBL5661927 ChEMBL | P11166 | 7.09 ~81.3 nM | 536.5 Da LogP 4.92 TPSA 103.9 | 1 viol. | ✓ Clean |
Cc1c(NC(=O)c2cc(C(=O)N3CCC3)nc3cc(F)ccc23)c(C(F…
|
| CHEMBL5661924 ChEMBL | P11166 | 7.06 ~87.1 nM | 535.3 Da LogP 6.46 TPSA 59.8 | 2 viol. | ✓ Clean |
Cc1nn(CCc2ccc(F)cc2)c(C)c1NC(=O)c1cc(C(F)(F)F)n…
|
| CHEMBL3780460 ChEMBL | P11169 | 7.05 ~89.1 nM | 422.4 Da LogP 3.43 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCN(c2ncnc3c2cnn3-c2cc(F)cc(F)c2)CC1
|
| CHEMBL5661867 ChEMBL | P11166 | 7.05 ~89.1 nM | 487.4 Da LogP 3.16 TPSA 152.7 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cc(F)ccc23)c(C(F)(F)F…
|
| CHEMBL5661935 ChEMBL | P11166 | 7.03 ~93.3 nM | 442.4 Da LogP 5.51 TPSA 59.8 | 1 viol. | ✓ Clean |
Cc1nn(Cc2ccc(F)cc2)c(C)c1NC(=O)c1cc(C(F)(F)F)nc…
|
| CHEMBL3780043 ChEMBL | P11169 | 7.02 ~95.5 nM | 400.5 Da LogP 3.46 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCN(c2ncnc3c2cnn3-c2cccc(C)c2)CC1
|
| CHEMBL4648466 ChEMBL | P11169 | 7.01 ~97.7 nM | 470.5 Da LogP 4.21 TPSA 114.1 | ✓ Ro5 | ✓ Clean |
CC(C)NC(=O)COc1cccc(-c2nc3c(c(Nc4ccc(-c5cn[nH]c…
|
| CHEMBL111738 ChEMBL | P11166 | 7.00 ~100.0 nM | 672.9 Da LogP 4.09 TPSA 174.6 | 2 viol. | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@]2(O)[C@@]3(C)[C@@H](O)CCC…
|
| CHEMBL3781331 ChEMBL | P11168 | 7.00 ~100.0 nM | 429.5 Da LogP 2.25 TPSA 102.4 | ✓ Ro5 | ✓ Clean |
COc1ccc(C(N)=O)cc1N1CCN(c2ncnc3c2cnn3-c2ccccc2)…
|
| CHEMBL50588 ChEMBL | P11166 | 6.97 ~107.2 nM | 480.6 Da LogP 4.94 TPSA 52.2 | ✓ Ro5 | ✓ Clean |
CC[C@H]1CN2CCc3cc(OC)c(OC)cc3[C@@H]2C[C@@H]1C[C…
|
| CHEMBL3780235 ChEMBL | P11169 | 6.96 ~109.6 nM | 416.5 Da LogP 3.16 TPSA 68.5 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCN(c2ncnc3c2cnn3-c2ccccc2OC)CC1
|
| CHEMBL3781654 ChEMBL | P11166 | 6.96 ~109.6 nM | 404.4 Da LogP 3.29 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1cccc(F)c1N1CCN(c2ncnc3c2cnn3-c2ccccc2)CC1
|
| CHEMBL5661873 ChEMBL | P11169 | 6.96 ~109.6 nM | 508.5 Da LogP 4.04 TPSA 135.9 | 1 viol. | ✓ Clean |
COc1ccc2nc(C(N)=O)cc(C(=O)Nc3c(C(F)(F)F)nn(Cc4c…
|
| CHEMBL5661909 ChEMBL | P11166 | 6.96 ~109.6 nM | 468.5 Da LogP 6.36 TPSA 73.0 | 1 viol. | ✓ Clean |
Cc1cc(C)c2nc(-c3ccco3)cc(C(=O)Nc3c(C)nn(Cc4ccc(…
|
| CHEMBL3780527 ChEMBL | P11169 | 6.92 ~120.2 nM | 378.5 Da LogP 3.28 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCN(c2ncnc3c2cnn3C2CCCC2)CC1
|
| CHEMBL3781308 ChEMBL | P11169 | 6.92 ~120.2 nM | 400.5 Da LogP 3.54 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCN(c2ncnc3c2cnn3-c2ccccc2)CC1C
|
| CHEMBL3781741 ChEMBL | P11169 | 6.92 ~120.2 nM | 404.4 Da LogP 3.29 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCN(c2ncnc3c2cnn3-c2cccc(F)c2)CC1
|
| CHEMBL411729 ChEMBL | P11169 | 6.92 ~120.2 nM | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@@H](C)[C@H]2[C@H](Cc3ccccc3)NC(=O)[C@]23…
|
| CHEMBL4637134 ChEMBL | P11169 | 6.92 ~120.2 nM | 511.6 Da LogP 4.61 TPSA 116.9 | 1 viol. | ✓ Clean |
CCC(CC)NC(=O)COc1cccc(-c2nc3c(c(Nc4ccc(-c5cn[nH…
|
| CHEMBL535077 ChEMBL | P11166 | 6.91 ~123.0 nM | 501.1 Da LogP 5.29 TPSA 63.2 | 2 viol. | ✓ Clean |
CC[C@H]1CN2CCc3cc(OC)c(OC)cc3[C@@H]2C[C@@H]1C[C…
|
| CHEMBL5661938 ChEMBL | P11166 | 6.89 ~128.8 nM | 402.5 Da LogP 5.10 TPSA 59.8 | 1 viol. | ✓ Clean |
Cc1ccc2nc(C)cc(C(=O)Nc3c(C)nn(Cc4ccc(F)cc4)c3C)…
|
| CHEMBL4635564 ChEMBL | P11169 | 6.86 ~138.0 nM | 509.6 Da LogP 4.36 TPSA 116.9 | 1 viol. | ✓ Clean |
O=C(COc1cccc(-c2nc3c(c(Nc4ccc(-c5cn[nH]c5)cc4)n…
|
| CHEMBL4089982 ChEMBL | P11166 | 6.85 ~141.3 nM | 495.4 Da LogP 4.61 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
COc1ccc(CC(=O)N[C@@H](Cc2ccccc2Br)C(=O)N[C@@H](…
|
| CHEMBL4634012 ChEMBL | P11169 | 6.81 ~154.9 nM | 567.7 Da LogP 4.72 TPSA 117.3 | 1 viol. | ✓ Clean |
CC(C)(C)NC(=O)COc1cccc(-c2nc3c(c(Nc4ccc(-c5cn[n…
|
| CHEMBL4635844 ChEMBL | P11169 | 6.80 ~158.5 nM | 510.5 Da LogP 4.36 TPSA 114.1 | 1 viol. | ✓ Clean |
O=C(COc1cccc(-c2nc3c(c(Nc4ccc(-c5cn[nH]c5)cc4)n…
|
| CHEMBL3781183 ChEMBL | P11169 | 6.77 ~169.8 nM | 411.5 Da LogP 3.02 TPSA 83.1 | ✓ Ro5 | ✓ Clean |
COc1cc(C#N)ccc1N1CCN(c2ncnc3c2cnn3-c2ccccc2)CC1
|
| CHEMBL3781625 ChEMBL | P11169 | 6.77 ~169.8 nM | 416.5 Da LogP 3.16 TPSA 68.5 | ✓ Ro5 | ✓ Clean |
COc1ccc(-n2ncc3c(N4CCN(c5ccccc5OC)CC4)ncnc32)cc1
|
| CHEMBL4638542 ChEMBL | P11169 | 6.76 ~173.8 nM | 555.7 Da LogP 4.58 TPSA 117.3 | 1 viol. | ✓ Clean |
COCCN1CCc2nc(-c3cccc(OCC(=O)NC(C)(C)C)c3)nc(Nc3…
|
| CHEMBL4647401 ChEMBL | P11169 | 6.75 ~177.8 nM | 549.7 Da LogP 5.24 TPSA 108.1 | 2 viol. | ✓ Clean |
CC1(NC(=O)COc2cccc(-c3nc4c(c(Nc5ccc(-c6cn[nH]c6…
|
| CHEMBL535750 ChEMBL | P11166 | 6.72 ~190.5 nM | 673.4 Da LogP 5.82 TPSA 63.2 | 2 viol. | ✓ Clean |
Br.CC[C@H]1CN2CCc3cc(OC)c(OC)cc3[C@@H]2C[C@@H]1…
|
| CHEMBL3781194 ChEMBL | P11169 | 6.70 ~199.5 nM | 411.5 Da LogP 3.02 TPSA 83.1 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCN(c2ncnc3c2cnn3-c2ccc(C#N)cc2)CC1
|
| CHEMBL5661853 ChEMBL | P11166 | 6.70 ~199.5 nM | 428.4 Da LogP 2.88 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2ccnc(C(N)=O)c2)c(C(F)(F)F)nn1Cc1cc…
|
| CHEMBL532464 ChEMBL | P11166 | 6.69 ~204.2 nM | 333.4 Da LogP 2.53 TPSA 101.2 | ✓ Ro5 | ✓ Clean |
Nc1nc(N)c2c(ccc3c2ccn3Cc2ccc3c(c2)OCO3)n1
|
| CHEMBL4645036 ChEMBL | P11169 | 6.68 ~208.9 nM | 535.7 Da LogP 4.85 TPSA 108.1 | 1 viol. | ✓ Clean |
CC1(NC(=O)COc2cccc(-c3nc4c(c(Nc5ccc(-c6cn[nH]c6…
|
| CHEMBL526110 ChEMBL | P11166 | 6.68 ~208.9 nM | 333.3 Da LogP 2.84 TPSA 111.1 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1cccc(Nc2nccc(-c3cnn4ncccc34)n2)c1
|
| CHEMBL3780717 ChEMBL | P11168 | 6.66 ~218.8 nM | 381.4 Da LogP 3.01 TPSA 73.9 | ✓ Ro5 | ✓ Clean |
N#Cc1cccc(N2CCN(c3ncnc4c3cnn4-c3ccccc3)CC2)c1
|
| CHEMBL581702 ChEMBL | P11166 | 6.65 ~223.9 nM | 319.4 Da LogP 2.81 TPSA 92.0 | ✓ Ro5 | ✓ Clean |
COc1cccc(Cn2ccc3c4c(N)nc(N)nc4ccc32)c1
|
| CHEMBL5661843 ChEMBL | P11169 | 6.64 ~229.1 nM | 496.4 Da LogP 4.17 TPSA 126.7 | ✓ Ro5 | ✓ Clean |
Cc1c(NC(=O)c2cc(C(N)=O)nc3cccc(F)c23)c(C(F)(F)F…
|
| CHEMBL587029 ChEMBL | P11166 | 6.64 ~229.1 nM | 365.9 Da LogP 4.35 TPSA 49.7 | ✓ Ro5 | ✓ Clean |
CN(C)Cc1cccc(-c2cc3c(-c4cnn(C)c4)c(Cl)cnc3[nH]2…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100006440 ZINC | 1.000 | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@@H](C)[C@H]2[C@@H](Cc3ccccc3)NC(=O)[C@@]…
|
| ZINC104201097 ZINC | 1.000 | 339.8 Da LogP 4.65 TPSA 72.5 | ✓ Ro5 | Alert |
Cc1nn(C(=O)c2ccncc2)c(C)c1/N=N\c1ccc(Cl)cc1
|
| ZINC1132773 ZINC | 1.000 | 386.5 Da LogP 3.15 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1cccc(N2CCN(c3ncnc4c3cnn4-c3ccccc3)CC2)c1
|
| ZINC11592912 ZINC | 1.000 | 281.4 Da LogP 1.04 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@@H](C)C[C@H]([C@@H](O)CC2CC(=O)NC(=O…
|
| ZINC1245411 ZINC | 1.000 | 400.5 Da LogP 3.46 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCN(c2ncnc3c2cnn3-c2cccc(C)c2)CC1
|
| ZINC13719850 ZINC | 1.000 | 281.4 Da LogP 1.04 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C[C@@H]1C[C@@H]([C@@H](O)CC2CC(=O)NC(=O)C2)C(=O…
|
| ZINC1501016272 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC/C=C\CCCCCCC(=O)OC[C@H](O)CO
|
| ZINC1501016273 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC/C=C\CCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC1772591577 ZINC | 1.000 | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@@H](C)[C@H]2[C@H](Cc3ccccc3)NC(=O)[C@]23…
|
| ZINC18168913 ZINC | 1.000 | 339.8 Da LogP 4.65 TPSA 72.5 | ✓ Ro5 | Alert |
Cc1nn(C(=O)c2ccncc2)c(C)c1/N=N/c1ccc(Cl)cc1
|
| ZINC2069495472 ZINC | 1.000 | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@@H](C)[C@H]2[C@H](Cc3ccccc3)NC(=O)[C@]23…
|
| ZINC207230601 ZINC | 1.000 | 400.5 Da LogP 3.54 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCCN(c2ncnc3c2cnn3-c2ccccc2)CC1
|
| ZINC2080376185 ZINC | 1.000 | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@@H](C)[C@H]2[C@H](Cc3ccccc3)NC(=O)[C@@]2…
|
| ZINC2115567 ZINC | 1.000 | 281.4 Da LogP 1.04 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@@H](C)C[C@@H]([C@H](O)CC2CC(=O)NC(=O…
|
| ZINC221534416 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCC(=O)OC[C@@H](O)CO
|
| ZINC252484626 ZINC | 1.000 | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@@H](C)[C@H]2[C@@H](Cc3ccccc3)NC(=O)[C@]2…
|
| ZINC252484627 ZINC | 1.000 | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@@H](C)[C@H]2[C@@H](Cc3ccccc3)NC(=O)[C@]2…
|
| ZINC253494688 ZINC | 1.000 | 265.3 Da LogP 0.50 TPSA 67.8 | ✓ Ro5 | ✓ Clean |
COc1ccc(C[C@@H]2NC[C@@H](O)[C@H]2OC(C)=O)cc1
|
| ZINC253839016 ZINC | 1.000 | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@@H](C)[C@H]2[C@H](Cc3ccccc3)NC(=O)[C@]23…
|
| ZINC2567912 ZINC | 1.000 | 281.4 Da LogP 1.04 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@H](C)C(=O)[C@@H]([C@H](O)CC2CC(=O)NC…
|
| ZINC299811548 ZINC | 1.000 | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@@H](O)[C@@H]2C=CC[C@@H](C)CCC[C@@H](O)C=…
|
| ZINC299811549 ZINC | 1.000 | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@H](C)[C@@H]2[C@H](Cc3ccccc3)NC(=O)[C@]23…
|
| ZINC299811550 ZINC | 1.000 | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@H](O)[C@@H]2C=CC[C@@H](C)CCC[C@@H](O)C=C…
|
| ZINC299811551 ZINC | 1.000 | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@@H](O)[C@H]2C=CC[C@@H](C)CCC[C@@H](O)C=C…
|
| ZINC32840894 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C/CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840895 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840896 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C/CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840902 ZINC | 1.000 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C/CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC3871566 ZINC | 1.000 | 265.3 Da LogP 0.50 TPSA 67.8 | ✓ Ro5 | ✓ Clean |
COc1ccc(C[C@H]2NC[C@@H](O)[C@H]2OC(C)=O)cc1
|
| ZINC3871567 ZINC | 1.000 | 265.3 Da LogP 0.50 TPSA 67.8 | ✓ Ro5 | ✓ Clean |
COc1ccc(C[C@H]2NC[C@@H](O)[C@@H]2OC(C)=O)cc1
|
| ZINC3871569 ZINC | 1.000 | 265.3 Da LogP 0.50 TPSA 67.8 | ✓ Ro5 | ✓ Clean |
COc1ccc(C[C@H]2NC[C@H](O)[C@@H]2OC(C)=O)cc1
|
| ZINC3872170 ZINC | 1.000 | 281.4 Da LogP 1.04 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@H](C)C(=O)[C@H]([C@H](O)CC2CC(=O)NC(…
|
| ZINC3872171 ZINC | 1.000 | 281.4 Da LogP 1.04 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@@H]([C@H](O)CC2CC(=O)NC(=O)C2)C(=O)[…
|
| ZINC3872172 ZINC | 1.000 | 281.4 Da LogP 1.04 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C[C@@H]1C[C@@H]([C@H](O)CC2CC(=O)NC(=O)C2)C(=O)…
|
| ZINC3932776 ZINC | 1.000 | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@@H](C)[C@H]2[C@H](Cc3ccccc3)NC(=O)[C@]23…
|
| ZINC402718 ZINC | 1.000 | 265.3 Da LogP 0.50 TPSA 67.8 | ✓ Ro5 | ✓ Clean |
COc1ccc(C[C@@H]2NC[C@@H](O)[C@@H]2OC(C)=O)cc1
|
| ZINC4073970 ZINC | 1.000 | 281.4 Da LogP 1.04 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@@H](C)C(=O)[C@@H]([C@H](O)CC2CC(=O)N…
|
| ZINC5528197 ZINC | 1.000 | 281.4 Da LogP 1.04 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@@H](C)C[C@@H]([C@@H](O)CC2CC(=O)NC(=…
|
| ZINC5529502 ZINC | 1.000 | 281.4 Da LogP 1.04 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@H](C)C(=O)[C@H]([C@@H](O)CC2CC(=O)NC…
|
| ZINC647844791 ZINC | 1.000 | 386.5 Da LogP 3.15 TPSA 59.3 | ✓ Ro5 | ✓ Clean |
COc1ccccc1N1CCN(c2ncnc3c2ncn3-c2ccccc2)CC1
|
| ZINC72107414 ZINC | 1.000 | 281.4 Da LogP 1.04 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@@H](C)C[C@H]([C@H](O)CC2CC(=O)NC(=O)…
|
| ZINC725433050 ZINC | 1.000 | 342.5 Da LogP 4.53 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC76945157 ZINC | 1.000 | 479.6 Da LogP 3.49 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
C=C1[C@@H](C)[C@H]2[C@@H](Cc3ccccc3)NC(=O)[C@@]…
|
| ZINC7997818 ZINC | 1.000 | 265.3 Da LogP 0.50 TPSA 67.8 | ✓ Ro5 | ✓ Clean |
COc1ccc(C[C@@H]2NC[C@H](O)[C@@H]2OC(C)=O)cc1
|
| ZINC7998095 ZINC | 1.000 | 265.3 Da LogP 0.50 TPSA 67.8 | ✓ Ro5 | ✓ Clean |
COc1ccc(C[C@@H]2NC[C@H](O)[C@H]2OC(C)=O)cc1
|
| ZINC8579261 ZINC | 1.000 | 281.4 Da LogP 1.04 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@@H](C)C(=O)[C@@H]([C@@H](O)CC2CC(=O)…
|
| ZINC8618456 ZINC | 1.000 | 242.2 Da LogP 0.73 TPSA 94.7 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2nc([C@@H](O)c3ccccc3)[nH]c12
|
| ZINC8618458 ZINC | 1.000 | 242.2 Da LogP 0.73 TPSA 94.7 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2nc([C@H](O)c3ccccc3)[nH]c12
|
| ZINC954 ZINC | 1.000 | 265.3 Da LogP 0.50 TPSA 67.8 | ✓ Ro5 | ✓ Clean |
COc1ccc(C[C@H]2NC[C@H](O)[C@H]2OC(C)=O)cc1
|
| ZINC98208566 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCC(=O)OC[C@H](O)CO
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.