Protein target profile

KP13_32245

N-acetylmuramoyl-L-alanine amidase AmiC

Genome: KpKP13 Gene: AHE42868.1 amiC 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GXU3
Length 417
Pocket druggability 0.771
Direct ligand evidence 0 17 total records
Functional annotation 1 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
52.078 Higher values support similarity to known essential genes.
DEG E-value
8.869999999999999e-141 Smaller values mean stronger essential-gene similarity.

Localization

Localization
Unknown

Structure confidence

ColabFold pLDDT
88.66 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.771
Structure A0A0H3GXU3
Pocket Pocket 1
P2Rank 0.44
Structure A0A0H3GXU3
Pocket Pocket 1
ColabFold model
FPocket 0.568 · Pocket 28
P2Rank 0.46 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 123 / 4744 genomes with a hit
Prevalence 2.6%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MSGNNSGLSRRRLLQGAGAMWLMSVSPVGLAAAARVVAVRVWPASTYTRVTVESNHVLKYRQFALSNPERVVVDLEGVNLNSVLKGMGGQIRADDPFIKSARVGQFDPQTVRMVFELKQNVKPQLFALAPVAGFKERLVMDLYPANATDVQDPLLALLEDYNKGDLERQVPPAQSGPQPGKAGRDRPIVIMLDPGHGGEDSGAVGKYRTREKDVVLQIARRLRALIDKEGNMKAYMTRNEDVFIPLKVRVAKAQKQRADLFVSIHADAFTSRQPSGSSVFALSTKGATSTAAKYLAQTQNASDLIGGVSKSGDRYVDHTMFDMVQSLTIADSLKFGKAVLEKMGNINNLHKNRVEQAGFAVLKAPDIPSILVETAFISNVEEERKLKTAKFQQEVAESILAGIKAYFADGATLARRG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0009253 The chemical reactions and pathways resulting in the breakdown of peptidoglycans, any of a class of glycoconjugates found in bacterial cell walls and consisting of long glycan strands of alternating residues of beta-(1,4) linked N-acetylglucosamine and N-acetylmuramic acid, cross-linked by short peptides.
  • GO:0008745 Catalysis of the hydrolysis of the link between N-acetylmuramoyl residues and L-amino acid residues in certain bacterial cell-wall glycopeptides.
  • GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
  • GO:0071555 A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

24 records
Show feature table
Start End DB Term Name
22 407 PANTHER PTHR30404 N-ACETYLMURAMOYL-L-ALANINE AMIDASE
39 142 Pfam PF11741 AMIN domain
39 142 InterPro IPR021731 AMIN domain
1 12 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
177 411 FunFam G3DSA:3.40.630.40:FF:000001 N-acetylmuramoyl-L-alanine amidase
26 145 Gene3D G3DSA:2.60.40.3500 -
1 33 Phobius SIGNAL_PEPTIDE Signal peptide region
166 185 MobiDBLite mobidb-lite consensus disorder prediction
1 408 NCBIfam NF038267 N-acetylmuramoyl-L-alanine amidase AmiC
189 404 CDD cd02696 MurNAc-LAA
189 404 InterPro IPR002508 N-acetylmuramoyl-L-alanine amidase, catalytic domain
26 33 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
24 145 FunFam G3DSA:2.60.40.3500:FF:000001 N-acetylmuramoyl-L-alanine amidase
250 404 SMART SM00646 ami_3
250 404 InterPro IPR002508 N-acetylmuramoyl-L-alanine amidase, catalytic domain
1 33 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
34 417 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
13 25 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
175 417 Gene3D G3DSA:3.40.630.40 -
1 34 ProSiteProfiles PS51318 Twin arginine translocation (Tat) signal profile.
1 34 InterPro IPR006311 Twin-arginine translocation pathway, signal sequence
188 407 SUPERFAMILY SSF53187 Zn-dependent exopeptidases
190 404 Pfam PF01520 N-acetylmuramoyl-L-alanine amidase
190 404 InterPro IPR002508 N-acetylmuramoyl-L-alanine amidase, catalytic domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.771
Show in viewer
Surrounding area
Site 2 FPocket #8
0.37
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.44
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.387
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.034
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.03
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.025
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GXU3
AlphaFold DB full sequence Viewing
ColabFold KP13_32245
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

17 records
Chemistry signal

Only proposed virtual-screening candidates are available for this target.

Direct evidence 0 same-protein records
Transferred evidence 0 records from similar proteins
Structural ligands 0 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 17 similarity-based ZINC candidates
Best available ligand signal
ZINC1532902 ZINC proposed compound Tanimoto 0.700 206.2 Da · LogP -0.86 · TPSA 132.1 Open detail ZINC
ZINC2018106 ZINC proposed compound · Tanimoto 0.700 Detail ZINC
ZINC3593496 ZINC proposed compound · Tanimoto 0.652 Detail ZINC
ZINC3593497 ZINC proposed compound · Tanimoto 0.652 Detail ZINC
ZINC14686440 ZINC proposed compound · Tanimoto 0.625 Detail ZINC

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Show only:
Ligand Tanimoto MW · LogP · TPSA Lipinski PAINS SMILES
ZINC1532902 ZINC 0.700 206.2 Da LogP -0.86 TPSA 132.1 ✓ Ro5 ✓ Clean O=C(O)CC[C@@](O)(CC(=O)O)C(=O)O
ZINC2018106 ZINC 0.700 206.2 Da LogP -0.86 TPSA 132.1 ✓ Ro5 ✓ Clean O=C(O)CC[C@](O)(CC(=O)O)C(=O)O
ZINC3593496 ZINC 0.652 206.2 Da LogP -1.16 TPSA 121.1 ✓ Ro5 ✓ Clean COC(=O)C[C@@](O)(CC(=O)O)C(=O)O
ZINC3593497 ZINC 0.652 206.2 Da LogP -1.16 TPSA 121.1 ✓ Ro5 ✓ Clean COC(=O)C[C@](O)(CC(=O)O)C(=O)O
ZINC14686440 ZINC 0.625 436.4 Da LogP -2.64 TPSA 247.9 1 viol. ✓ Clean O=C(O)C[C@](O)(CC(=O)NCCCCNC(=O)C[C@@](O)(CC(=O…
ZINC14686442 ZINC 0.625 436.4 Da LogP -2.64 TPSA 247.9 1 viol. ✓ Clean O=C(O)C[C@@](O)(CC(=O)NCCCCNC(=O)C[C@](O)(CC(=O…
ZINC14686444 ZINC 0.625 436.4 Da LogP -2.64 TPSA 247.9 1 viol. ✓ Clean O=C(O)C[C@@](O)(CC(=O)NCCCCNC(=O)C[C@@](O)(CC(=…
ZINC13398039 ZINC 0.577 234.2 Da LogP -0.38 TPSA 121.1 ✓ Ro5 ✓ Clean CC(C)OC(=O)C[C@](O)(CC(=O)O)C(=O)O
ZINC2528012 ZINC 0.577 234.2 Da LogP -0.38 TPSA 121.1 ✓ Ro5 ✓ Clean CC(C)OC(=O)C[C@@](O)(CC(=O)O)C(=O)O
ZINC146315135 ZINC 0.560 204.2 Da LogP 0.86 TPSA 94.8 ✓ Ro5 ✓ Clean CCCCC[C@@](O)(CC(=O)O)C(=O)O
ZINC146315336 ZINC 0.560 204.2 Da LogP 0.86 TPSA 94.8 ✓ Ro5 ✓ Clean CCCCC[C@](O)(CC(=O)O)C(=O)O
ZINC1850353 ZINC 0.556 206.1 Da LogP -0.86 TPSA 132.1 ✓ Ro5 ✓ Clean O=C(O)CC(O)(CC(=O)O)CC(=O)O
ZINC13398014 ZINC 0.522 220.2 Da LogP -1.07 TPSA 110.1 ✓ Ro5 ✓ Clean COC(=O)CC(O)(CC(=O)OC)C(=O)O
ZINC3861629 ZINC 0.522 206.1 Da LogP -1.16 TPSA 121.1 ✓ Ro5 ✓ Clean COC(=O)C(O)(CC(=O)O)CC(=O)O
ZINC100969993 ZINC 0.500 359.5 Da LogP 2.70 TPSA 123.9 ✓ Ro5 ✓ Clean CCCCCCCCCCCCNC(=O)C[C@](O)(CC(=O)O)C(=O)O
ZINC100969996 ZINC 0.500 359.5 Da LogP 2.70 TPSA 123.9 ✓ Ro5 ✓ Clean CCCCCCCCCCCCNC(=O)C[C@@](O)(CC(=O)O)C(=O)O
ZINC1711854 ZINC 0.500 248.2 Da LogP -0.13 TPSA 149.2 ✓ Ro5 ✓ Clean O=C(O)CC(CC(=O)O)(CC(=O)O)CC(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.