KpKP13 Protein target profile

Cobalt transport protein CbiQ

Accession: KP13_02338

Gene: cbiQ AHE42908.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GUL9
Export view
Length 225
Pocket druggability (P2Rank · AlphaFold DB model) 0.03
Functional annotation 0 EC 3 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Moderate predicted binding pocket FPocket selected-pocket score 0.41. This supports review but is not experimental validation. Structure available AlphaFold DB model + ColabFold model

Risks to review

Microbiome similarity 47 of 4744 screened genomes (1.0%) have a significant similarity hit. This target also has a predicted binding pocket (FPocket 0.41) — check the ligand evidence before deprioritizing on off-target risk alone. Weak second pocket-predictor signal P2Rank predicted binding-site probability 0.03.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
89.87 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.03
Structure A0A0H3GUL9
Pocket Pocket 1
Druggability (FPocket) 0.409
Structure A0A0H3GUL9
Pocket Pocket 7
ColabFold model
P2Rank 0.056 · Pocket 1
FPocket 0.646 · Pocket 18
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 47 / 4744 genomes with a hit
Prevalence 1.0%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GUL9

Sequence

Primary amino-acid sequence viewer.

MTGFDRLSYQSRWLQVAPERKFLLWLLLMALAFTLPAWGQALTLALTAALTCWLLRVSFWRWCRWMALPFGFLLVGVLTILFSVSRDPQMLLASLRLGAFSIGISAPGLAVAGETFWRSLAAMAATLWLVLNLPFPQLIILLKRGRVPRLLTEQILLTWRFIFILLDEAMAIHRAQTLRFGYGSVPQGYRSLAMLVGLLFTRVLLRYQQMSTALDIKLYQGDFHL

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

3
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0006824 The directed movement of cobalt (Co2+) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0043190 A complex for the transport of metabolites into and out of the cell, typically comprised of four domains; two membrane-associated domains and two ATP-binding domains at the intracellular face of the membrane, that form a central pore through the plasma membrane. Each of the four core domains may be encoded as a separate polypeptide or the domains can be fused in any one of a number of ways into multidomain polypeptides. In Bacteria and Archaebacteria, ABC transporters also include substrate binding proteins to bind substrate external to the cytoplasm and deliver it to the transporter.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

27 records
Show feature table
Start End DB Term Name
85 90 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
21 43 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
136 155 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
92 110 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
65 84 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 21 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
16 216 NCBIfam TIGR02454 cobalt ECF transporter T component CbiQ
16 216 InterPro IPR012809 Cobalt ECF transporter T component CbiQ
63 85 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
10 221 Pfam PF02361 Cobalt transport protein
10 221 InterPro IPR003339 ABC/ECF transporter, transmembrane component
116 135 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
111 115 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
156 175 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
91 110 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
187 205 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
42 64 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
22 33 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
3 225 PANTHER PTHR43723 COBALT TRANSPORT PROTEIN CBIQ
55 224 CDD cd16914 EcfT
34 41 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
187 205 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
176 186 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
120 142 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
206 225 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
1 41 Phobius SIGNAL_PEPTIDE Signal peptide region
155 172 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.03
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.024
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.002
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #7
0.409
Show in viewer
Surrounding area
Pocket 2 FPocket #15
0.27
Show in viewer
Surrounding area
Pocket 3 FPocket #1
0.241 Unusual size
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GUL9
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_02338
ColabFold — — full sequence — Loaded