KpKP13 Protein target profile

moeB family protein

Accession: KP13_02344

Gene: AHE42914.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GWY0
Length 273
Pocket druggability (P2Rank · AlphaFold DB model) 0.961
Direct ligand evidence 0 91 total records
Functional annotation 0 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
33.333 Lower values reduce human off-target concern.
Human E-value
1.93e-08
Gut microbiome similarity
3.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
57.588 Higher values support similarity to known essential genes.
DEG E-value
6.72e-113 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
93.81 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.961
Structure A0A0H3GWY0
Pocket Pocket 1
Druggability (FPocket) 0.751
Structure A0A0H3GWY0
Pocket Pocket 19
ColabFold model
P2Rank 0.943 · Pocket 1
FPocket 0.19 · Pocket 8
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 176 / 4744 genomes with a hit
Prevalence 3.7%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MSVVISDAWRQRFGGTARLYGEKALQCFADAHVCVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALSGNVGLAKAEVMAERIRLINPECRVTVVDDFVTPENVAEYLGVGFSYVIDAIDSVRPKAALIAWCRRYKVPLVTTGGAGGQIDPTQIQVADLAKTIQDPLAAKLRERLKSQFGVVKNSKGKLGVDCVFSTEALVYPQADGSVCAMKSTAEGPKRMDCASGFGAATMVTATFGFVAVSHALKKMLAKAQRDAAASGK

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

5
  • GO:0008641 Catalysis of the activation of small proteins, such as ubiquitin or ubiquitin-like proteins, through the formation of an ATP-dependent high-energy thiolester bond.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0061503 Catalysis of the ATP-dependent dehydration of t6A to form cyclic t6A.
  • GO:0061504 The chemical reactions and pathways resulting in the formation of cyclic threonylcarbamoyladenosine, a modified nucleoside found in some tRNA molecules.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
238 257 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
18 263 Pfam PF00899 ThiF family
18 263 InterPro IPR000594 THIF-type NAD/FAD binding fold
1 268 FunFam G3DSA:3.40.50.720:FF:000096 tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA
1 237 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
20 257 CDD cd00755 YgdL_like
235 257 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
10 261 SUPERFAMILY SSF69572 Activating enzymes of the ubiquitin-like proteins
10 261 InterPro IPR035985 Ubiquitin-activating enzyme
1 271 Gene3D G3DSA:3.40.50.720 -
258 273 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
7 267 PANTHER PTHR43267 TRNA THREONYLCARBAMOYLADENOSINE DEHYDRATASE
7 267 InterPro IPR045886 ThiF/MoeB/HesA family

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.961
Likely same site as FPocket 19 4.9 Å 32 shared residues 97% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.035
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #19
0.751 Unusual size
Likely same site as P2Rank 1 4.9 Å 32 shared residues 97% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GWY0
AlphaFold DB full sequence Viewing
ColabFold KP13_02344
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

91 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 41 records from similar proteins
Structural ligands 10 0 loaded crystals
Measured bioactivity 31 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
61T PDB via homolog 519.5 Da · LogP 1.75 · TPSA 152.1 Open detail RCSB PDB
6O2 PDB via homolog Detail RCSB PDB
8E7 PDB via homolog Detail RCSB PDB
8EA PDB via homolog Detail RCSB PDB
B39 PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
61T RCSB PDB P22515 519.5 Da LogP 1.75 TPSA 152.1 1 viol. ✓ Clean c1cc(cc(c1)SC(F)(F)F)c2cc3nccc(n3n2)N[C@@H]4C[C…
6O2 RCSB PDB P22515 446.4 Da LogP -0.61 TPSA 174.7 1 viol. ✓ Clean C#Cc1cccc(c1)Nc2c3c(ncn2)n(cn3)C4C(C(C(O4)COS(=…
8E7 RCSB PDB O94609 217.4 Da LogP 3.65 TPSA 12.0 ✓ Ro5 ✓ Clean CCCCCCCCCCNCCS
8EA RCSB PDB O94609 374.1 Da LogP 6.95 TPSA 12.0 1 viol. ✓ Clean CCCCCCCCCCNCCSSCc1ccc(cc1)Cl
B39 RCSB PDB P22515 443.5 Da LogP 2.06 TPSA 132.4 ✓ Ro5 ✓ Clean c1ccc2c(c1)CC[C@@H]2Nc3c4ccn(c4ncn3)[C@@H]5C[C@…
FHJ RCSB PDB Q9UBT2 421.5 Da LogP 3.30 TPSA 73.9 ✓ Ro5 ✓ Clean Cc1ccc(cc1)C[C@@H]([C@@]23C=C[C@@H](O2)[C@@H]([…
JZU RCSB PDB O94609 345.3 Da LogP -3.18 TPSA 191.5 ✓ Ro5 ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
PG0 RCSB PDB O94609 120.1 Da LogP -0.36 TPSA 38.7 ✓ Ro5 ✓ Clean COCCOCCO
POP RCSB PDB P22314 176.0 Da LogP -2.08 TPSA 129.9 ✓ Ro5 ✓ Clean O[P@@](=O)([O-])O[P@@](=O)(O)[O-]
VMX RCSB PDB O94609 387.4 Da LogP -2.70 TPSA 191.5 1 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.