Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 33.333 Lower values reduce human off-target concern.
- Human E-value
- 1.93e-08
- Gut microbiome similarity
- 3.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 57.588 Higher values support similarity to known essential genes.
- DEG E-value
- 6.72e-113 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 93.81 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Chemistry
Sequence
Primary amino-acid sequence viewer.
MSVVISDAWRQRFGGTARLYGEKALQCFADAHVCVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALSGNVGLAKAEVMAERIRLINPECRVTVVDDFVTPENVAEYLGVGFSYVIDAIDSVRPKAALIAWCRRYKVPLVTTGGAGGQIDPTQIQVADLAKTIQDPLAAKLRERLKSQFGVVKNSKGKLGVDCVFSTEALVYPQADGSVCAMKSTAEGPKRMDCASGFGAATMVTATFGFVAVSHALKKMLAKAQRDAAASGK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
5- GO:0008641 Catalysis of the activation of small proteins, such as ubiquitin or ubiquitin-like proteins, through the formation of an ATP-dependent high-energy thiolester bond.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
- GO:0061503 Catalysis of the ATP-dependent dehydration of t6A to form cyclic t6A.
- GO:0061504 The chemical reactions and pathways resulting in the formation of cyclic threonylcarbamoyladenosine, a modified nucleoside found in some tRNA molecules.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 238 | 257 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 18 | 263 | Pfam | PF00899 | ThiF family |
| 18 | 263 | InterPro | IPR000594 | THIF-type NAD/FAD binding fold |
| 1 | 268 | FunFam | G3DSA:3.40.50.720:FF:000096 | tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA |
| 1 | 237 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 20 | 257 | CDD | cd00755 | YgdL_like |
| 235 | 257 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 10 | 261 | SUPERFAMILY | SSF69572 | Activating enzymes of the ubiquitin-like proteins |
| 10 | 261 | InterPro | IPR035985 | Ubiquitin-activating enzyme |
| 1 | 271 | Gene3D | G3DSA:3.40.50.720 | - |
| 258 | 273 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 7 | 267 | PANTHER | PTHR43267 | TRNA THREONYLCARBAMOYLADENOSINE DEHYDRATASE |
| 7 | 267 | InterPro | IPR045886 | ThiF/MoeB/HesA family |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GWY0
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_02344
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 61T RCSB PDB | P22515 | 519.5 Da LogP 1.75 TPSA 152.1 | 1 viol. | ✓ Clean |
c1cc(cc(c1)SC(F)(F)F)c2cc3nccc(n3n2)N[C@@H]4C[C…
|
|
| 6O2 RCSB PDB | P22515 | 446.4 Da LogP -0.61 TPSA 174.7 | 1 viol. | ✓ Clean |
C#Cc1cccc(c1)Nc2c3c(ncn2)n(cn3)C4C(C(C(O4)COS(=…
|
|
| 8E7 RCSB PDB | O94609 | 217.4 Da LogP 3.65 TPSA 12.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCNCCS
|
|
| 8EA RCSB PDB | O94609 | 374.1 Da LogP 6.95 TPSA 12.0 | 1 viol. | ✓ Clean |
CCCCCCCCCCNCCSSCc1ccc(cc1)Cl
|
|
| B39 RCSB PDB | P22515 | 443.5 Da LogP 2.06 TPSA 132.4 | ✓ Ro5 | ✓ Clean |
c1ccc2c(c1)CC[C@@H]2Nc3c4ccn(c4ncn3)[C@@H]5C[C@…
|
|
| FHJ RCSB PDB | Q9UBT2 | 421.5 Da LogP 3.30 TPSA 73.9 | ✓ Ro5 | ✓ Clean |
Cc1ccc(cc1)C[C@@H]([C@@]23C=C[C@@H](O2)[C@@H]([…
|
|
| JZU RCSB PDB | O94609 | 345.3 Da LogP -3.18 TPSA 191.5 | ✓ Ro5 | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| PG0 RCSB PDB | O94609 | 120.1 Da LogP -0.36 TPSA 38.7 | ✓ Ro5 | ✓ Clean |
COCCOCCO
|
|
| POP RCSB PDB | P22314 | 176.0 Da LogP -2.08 TPSA 129.9 | ✓ Ro5 | ✓ Clean |
O[P@@](=O)([O-])O[P@@](=O)(O)[O-]
|
|
| VMX RCSB PDB | O94609 | 387.4 Da LogP -2.70 TPSA 191.5 | 1 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL5747752 ChEMBL | P22314 | 7.26 ~55.0 nM | 523.6 Da LogP 1.37 TPSA 169.1 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4cccc(C(…
|
| CHEMBL5759269 ChEMBL | P22314 | 7.26 ~55.0 nM | 419.5 Da LogP 0.14 TPSA 152.1 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4ccccc4)…
|
| CHEMBL5768102 ChEMBL | P22314 | 7.26 ~55.0 nM | 470.5 Da LogP 0.69 TPSA 165.0 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4cnc5ccc…
|
| CHEMBL5780833 ChEMBL | P22314 | 7.26 ~55.0 nM | 488.4 Da LogP 1.45 TPSA 152.1 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4ccc(Cl)…
|
| CHEMBL5803994 ChEMBL | P22314 | 7.26 ~55.0 nM | 488.4 Da LogP 0.55 TPSA 165.0 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4ccnc(C(…
|
| CHEMBL5828810 ChEMBL | P22314 | 7.26 ~55.0 nM | 519.5 Da LogP 1.75 TPSA 152.1 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4ccc(SC(…
|
| CHEMBL5832385 ChEMBL | P22314 | 7.26 ~55.0 nM | 519.5 Da LogP 1.75 TPSA 152.1 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4ccccc4S…
|
| CHEMBL5864078 ChEMBL | P22314 | 7.26 ~55.0 nM | 420.5 Da LogP -0.47 TPSA 165.0 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4ccccn4)…
|
| CHEMBL5887314 ChEMBL | P22314 | 7.26 ~55.0 nM | 489.6 Da LogP 0.81 TPSA 161.3 | ✓ Ro5 | ✓ Clean |
CC1(C)COc2c(-c3cc4nccc(N[C@@H]5C[C@H](COS(N)(=O…
|
| CHEMBL5918592 ChEMBL | P22314 | 7.26 ~55.0 nM | 488.4 Da LogP 0.55 TPSA 165.0 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4cccc(C(…
|
| CHEMBL5940945 ChEMBL | P22314 | 7.26 ~55.0 nM | 509.6 Da LogP 1.73 TPSA 152.1 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4cccc(Cc…
|
| CHEMBL5954380 ChEMBL | P22314 | 7.26 ~55.0 nM | 493.5 Da LogP 1.22 TPSA 152.1 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4ccc(C(F…
|
| CHEMBL5958476 ChEMBL | P22314 | 7.26 ~55.0 nM | 511.6 Da LogP 1.93 TPSA 161.3 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4ccccc4O…
|
| CHEMBL5971124 ChEMBL | P22314 | 7.26 ~55.0 nM | 458.5 Da LogP 0.62 TPSA 167.9 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4ccc5[nH…
|
| CHEMBL5997651 ChEMBL | P22314 | 7.26 ~55.0 nM | 510.0 Da LogP 2.01 TPSA 152.1 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4cc5ccc(…
|
| CHEMBL6003529 ChEMBL | P22314 | 7.26 ~55.0 nM | 511.6 Da LogP 1.93 TPSA 161.3 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4cccc(Oc…
|
| CHEMBL6053122 ChEMBL | P22314 | 7.26 ~55.0 nM | 538.4 Da LogP 2.60 TPSA 152.1 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2ccnc3cc(-c4c(Cl)cc…
|
| CHEMBL6065415 ChEMBL | P22314 | 7.26 ~55.0 nM | 503.6 Da LogP 1.92 TPSA 152.1 | 1 viol. | ✓ Clean |
CCc1ccc2sc(-c3cc4nccc(N[C@@H]5C[C@H](COS(N)(=O)…
|
| CHEMBL5177755 ChEMBL | P22314 | 7.18 ~66.1 nM | 572.6 Da LogP 1.41 TPSA 187.7 | 2 viol. | ✓ Clean |
COC(=O)N1CCC2(CC1)C[C@H](Nc1ncnc3c1nnn3[C@@H]1C…
|
| CHEMBL5175806 ChEMBL | P22314 | 6.35 ~446.7 nM | 506.5 Da LogP -0.64 TPSA 187.8 | 1 viol. | ✓ Clean |
CCOc1cccc(F)c1C#Cc1cn([C@@H]2O[C@H](CNS(N)(=O)=…
|
| CHEMBL5743820 ChEMBL | P22314 | 6.26 ~549.5 nM | 453.9 Da LogP 0.79 TPSA 152.1 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2cc(Cl)nc3cc(-c4ccc…
|
| CHEMBL5762899 ChEMBL | P22314 | 6.26 ~549.5 nM | 483.9 Da LogP 0.80 TPSA 161.3 | ✓ Ro5 | ✓ Clean |
COc1ccc(-c2cc3nc(Cl)cc(N[C@@H]4C[C@H](COS(N)(=O…
|
| CHEMBL5769060 ChEMBL | P22314 | 6.26 ~549.5 nM | 554.0 Da LogP 2.40 TPSA 152.1 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2c(Cl)cnc3cc(-c4ccc…
|
| CHEMBL5793677 ChEMBL | P22314 | 6.26 ~549.5 nM | 433.5 Da LogP 0.45 TPSA 152.1 | ✓ Ro5 | ✓ Clean |
Cc1cc(N[C@@H]2C[C@H](COS(N)(=O)=O)[C@@H](O)[C@H…
|
| CHEMBL5799754 ChEMBL | P22314 | 6.26 ~549.5 nM | 504.0 Da LogP 1.95 TPSA 152.1 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2cc(Cl)nc3cc(-c4ccc…
|
| CHEMBL5866556 ChEMBL | P22314 | 6.26 ~549.5 nM | 532.8 Da LogP 1.55 TPSA 152.1 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2cc(Cl)nc3cc(-c4ccc…
|
| CHEMBL5929395 ChEMBL | P22314 | 6.26 ~549.5 nM | 433.5 Da LogP 0.45 TPSA 152.1 | ✓ Ro5 | ✓ Clean |
Cc1cnc2cc(-c3ccccc3)nn2c1N[C@@H]1C[C@H](COS(N)(…
|
| CHEMBL5960054 ChEMBL | P22314 | 6.26 ~549.5 nM | 588.4 Da LogP 3.06 TPSA 152.1 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2c(Cl)cnc3c(Cl)c(-c…
|
| CHEMBL6054356 ChEMBL | P22314 | 6.26 ~549.5 nM | 454.9 Da LogP 0.19 TPSA 165.0 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@H]1C[C@@H](Nc2cc(Cl)nc3cc(-c4ccc…
|
| CHEMBL2017005 ChEMBL | Q8TBC4 | — | 462.5 Da LogP -0.24 TPSA 174.7 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N[C@H]4CCc5cc…
|
| CHEMBL2017007 ChEMBL | Q8TBC4 | — | 430.5 Da LogP -0.34 TPSA 174.7 | 1 viol. | ✓ Clean |
CCCCCCNc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1580161 ZINC | 1.000 | 208.3 Da LogP -0.33 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCO
|
| ZINC16052118 ZINC | 1.000 | 340.4 Da LogP -0.28 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCO
|
| ZINC16052257 ZINC | 1.000 | 384.5 Da LogP -0.26 TPSA 94.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC169303181 ZINC | 1.000 | 443.5 Da LogP 2.06 TPSA 132.4 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@@H]1C[C@H](n2ccc3c(N[C@H]4CCc5cc…
|
| ZINC1736661 ZINC | 1.000 | 217.4 Da LogP 3.65 TPSA 12.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCNCCS
|
| ZINC195500401 ZINC | 1.000 | 443.5 Da LogP 2.06 TPSA 132.4 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@@H]1C[C@H](n2ccc3c(N[C@@H]4CCc5c…
|
| ZINC255988279 ZINC | 1.000 | 443.5 Da LogP 2.06 TPSA 132.4 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@@H]1C[C@H](n2ccc3c(N[C@@H]4CCc5c…
|
| ZINC34317654 ZINC | 1.000 | 472.6 Da LogP -0.23 TPSA 112.5 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC44076059 ZINC | 1.000 | 428.5 Da LogP -0.24 TPSA 103.3 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5210101 ZINC | 1.000 | 252.3 Da LogP -0.31 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCO
|
| ZINC58660702 ZINC | 1.000 | 443.5 Da LogP 2.06 TPSA 132.4 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@@H]1C[C@@H](n2ccc3c(N[C@H]4CCc5c…
|
| ZINC5997860 ZINC | 1.000 | 296.4 Da LogP -0.29 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCO
|
| ZINC72190143 ZINC | 1.000 | 443.5 Da LogP 2.06 TPSA 132.4 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@@H]1C[C@@H](n2ccc3c(N[C@@H]4CCc5…
|
| ZINC84635086 ZINC | 1.000 | 462.5 Da LogP -0.24 TPSA 174.7 | 1 viol. | ✓ Clean |
NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N[C@H]4CCc5cc…
|
| ZINC95616587 ZINC | 1.000 | 443.5 Da LogP 2.06 TPSA 132.4 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)OC[C@@H]1C[C@H](n2ccc3c(N[C@H]4CCc5cc…
|
| ZINC135730119 ZINC | 0.761 | 383.4 Da LogP 0.54 TPSA 125.6 | ✓ Ro5 | ✓ Clean |
OC[C@@H]1O[C@H](n2cnc3c(N[C@@H]4CCc5ccccc54)ncn…
|
| ZINC25995248 ZINC | 0.761 | 383.4 Da LogP 0.54 TPSA 125.6 | ✓ Ro5 | ✓ Clean |
OC[C@@H]1O[C@H](n2cnc3c(N[C@@H]4CCc5ccccc54)ncn…
|
| ZINC36271892 ZINC | 0.761 | 383.4 Da LogP 0.54 TPSA 125.6 | ✓ Ro5 | ✓ Clean |
OC[C@@H]1O[C@H](n2cnc3c(N[C@@H]4CCc5ccccc54)ncn…
|
| ZINC3780890 ZINC | 0.761 | 383.4 Da LogP 0.54 TPSA 125.6 | ✓ Ro5 | ✓ Clean |
OC[C@H]1O[C@@H](n2cnc3c(N[C@@H]4CCc5ccccc54)ncn…
|
| ZINC504656674 ZINC | 0.761 | 383.4 Da LogP 0.54 TPSA 125.6 | ✓ Ro5 | ✓ Clean |
OC[C@@H]1O[C@H](n2cnc3c(N[C@@H]4CCc5ccccc54)ncn…
|
| ZINC95079892 ZINC | 0.742 | 364.4 Da LogP 2.84 TPSA 83.2 | ✓ Ro5 | ✓ Clean |
OC[C@@H]1C[C@@H](n2ccc3c(N[C@H]4CCc5ccccc54)ncn…
|
| ZINC100027350 ZINC | 0.737 | 227.4 Da LogP 4.91 TPSA 12.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCNCCCCCCC
|
| ZINC1724011 ZINC | 0.737 | 213.4 Da LogP 4.52 TPSA 12.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCNCCCCCCC
|
| ZINC575419714 ZINC | 0.727 | 312.4 Da LogP 0.42 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCSCCOCCOCCO
|
| ZINC100050955 ZINC | 0.700 | 327.6 Da LogP 4.48 TPSA 36.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCNCCNCCNCCCCCCCC
|
| ZINC100924963 ZINC | 0.700 | 284.5 Da LogP 4.89 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCNCCNCCCCCCCC
|
| ZINC115163232 ZINC | 0.700 | 222.3 Da LogP 0.07 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCCO
|
| ZINC258837490 ZINC | 0.700 | 354.4 Da LogP 0.11 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCCO
|
| ZINC35052519 ZINC | 0.700 | 228.4 Da LogP 3.33 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
CCCCCCNCCNCCCCCC
|
| ZINC12501520 ZINC | 0.688 | 458.5 Da LogP -0.88 TPSA 123.5 | 1 viol. | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC1692489 ZINC | 0.688 | 222.3 Da LogP 0.33 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOC
|
| ZINC3874716 ZINC | 0.688 | 414.5 Da LogP -0.90 TPSA 114.3 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC4283769 ZINC | 0.688 | 238.3 Da LogP -0.96 TPSA 77.4 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCO
|
| ZINC4521548 ZINC | 0.688 | 282.3 Da LogP -0.95 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCO
|
| ZINC4530388 ZINC | 0.688 | 266.3 Da LogP 0.35 TPSA 55.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOC
|
| ZINC5178829 ZINC | 0.688 | 326.4 Da LogP -0.93 TPSA 95.8 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5178830 ZINC | 0.688 | 370.4 Da LogP -0.91 TPSA 105.1 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5701172 ZINC | 0.688 | 310.4 Da LogP 0.36 TPSA 64.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOC
|
| ZINC5997861 ZINC | 0.688 | 398.5 Da LogP 0.40 TPSA 83.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOC
|
| ZINC575432150 ZINC | 0.667 | 344.4 Da LogP -0.89 TPSA 100.5 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCS(=O)(=O)CCOCCOCCO
|
| ZINC1857524240 ZINC | 0.652 | 207.3 Da LogP -0.75 TPSA 60.0 | ✓ Ro5 | ✓ Clean |
COCCNCCOCCOCCO
|
| ZINC4977317 ZINC | 0.650 | 228.4 Da LogP 3.33 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
CCCCNCCCCCCNCCCC
|
| ZINC12405780 ZINC | 0.645 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@@H]…
|
| ZINC12502832 ZINC | 0.645 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@@H]…
|
| ZINC79460727 ZINC | 0.645 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@H](…
|
| ZINC79460732 ZINC | 0.645 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@H](…
|
| ZINC39645969 ZINC | 0.622 | 398.4 Da LogP 0.12 TPSA 151.6 | ✓ Ro5 | ✓ Clean |
Nc1nc(N[C@H]2CCc3ccccc32)c2ncn([C@@H]3O[C@H](CO…
|
| ZINC39645970 ZINC | 0.622 | 398.4 Da LogP 0.12 TPSA 151.6 | ✓ Ro5 | ✓ Clean |
Nc1nc(N[C@@H]2CCc3ccccc32)c2ncn([C@@H]3O[C@H](C…
|
| ZINC100016239 ZINC | 0.609 | 200.4 Da LogP 2.55 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCNCCCNCC
|
| ZINC100967545 ZINC | 0.609 | 256.5 Da LogP 4.24 TPSA 38.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCNCCN
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.