Protein target profile

KP13_02403

Adenylyl-sulfate kinase

Genome: KpKP13 Gene: cysC AHE42974.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GSB0
Length 201
Pocket druggability 0.934
Direct ligand evidence 0 58 total records
Functional annotation 1 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
52.683 Lower values reduce human off-target concern.
Human E-value
6.03e-63
Gut microbiome similarity
7.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
50.802 Higher values support similarity to known essential genes.
DEG E-value
9.46e-63 Smaller values mean stronger essential-gene similarity.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
96.12 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.934
Structure A0A0H3GSB0
Pocket Pocket 9
P2Rank 0.871
Structure A0A0H3GSB0
Pocket Pocket 1
ColabFold model
FPocket 0.846 · Pocket 1
P2Rank 0.914 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 370 / 4744 genomes with a hit
Prevalence 7.8%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MAQHDENVVWHAHPVTQQQREQHHGHRGVVLWFTGLSGSGKSTVAGALEEALHERGVSTYLLDGDNVRHGLCSDLGFSDEDRKENIRRVGEVARLMVDAGLVVLTAFISPHRAERQMVRERLGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPEKAEIHLDGEQLVTNLVHQLLDLLQQSDIIRS

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0000103 The pathways by which inorganic sulfate is processed and incorporated into sulfated compounds.
  • GO:0004020 Catalysis of the reaction: adenosine 5'-phosphosulfate + ATP = 3'-phosphoadenylyl sulfate + ADP + H+.
  • GO:0070814 The chemical reactions and pathways resulting in the formation of hydrogen sulfide, H2S.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
6 184 PANTHER PTHR11055 BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-PHOSPHOSULFATE SYNTHASE
30 177 CDD cd02027 APSK
30 177 InterPro IPR002891 Adenylyl-sulfate kinase
23 194 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
23 194 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
4 200 FunFam G3DSA:3.40.50.300:FF:000212 Adenylyl-sulfate kinase
10 193 NCBIfam TIGR00455 adenylyl-sulfate kinase
10 193 InterPro IPR002891 Adenylyl-sulfate kinase
27 179 Pfam PF01583 Adenylylsulphate kinase
26 197 Hamap MF_00065 Adenylyl-sulfate kinase [cysC].
26 197 InterPro IPR002891 Adenylyl-sulfate kinase
1 200 Gene3D G3DSA:3.40.50.300 -
1 200 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #9
0.934
Likely same site as P2Rank 1 2.4 Å 26 shared residues 93% of smaller site
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.871
Likely same site as FPocket 9 2.4 Å 26 shared residues 93% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:109-109 Phosphoserine intermediate
UniProt: Binding site:35-42
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GSB0
AlphaFold DB full sequence Viewing
ColabFold KP13_02403
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 8 records from similar proteins
Structural ligands 8 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
ADX PDB via homolog 427.3 Da · LogP -2.04 · TPSA 229.4 Open detail RCSB PDB
ANP PDB via homolog Detail RCSB PDB
AV2 PDB via homolog Detail RCSB PDB
CAC PDB via homolog Detail RCSB PDB
DAT PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ADX RCSB PDB O43252 427.3 Da LogP -2.04 TPSA 229.4 1 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ANP RCSB PDB P72940 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
AV2 RCSB PDB Q12657 509.1 Da LogP -1.45 TPSA 247.9 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@H]4[C@@H]([C@H](O3)C…
CAC RCSB PDB P72940 137.0 Da LogP -0.52 TPSA 40.1 ✓ Ro5 ✓ Clean C[As](=O)(C)[O-]
DAT RCSB PDB O43252 411.2 Da LogP -0.72 TPSA 212.4 1 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3C[C@@H]([C@H](O3)CO[P@]…
GGZ RCSB PDB O43252 489.3 Da LogP -0.87 TPSA 244.7 1 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@H]4[C@@H]([C@H](O3)C…
PPS RCSB PDB O43252 507.3 Da LogP -1.92 TPSA 276.0 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
TLA RCSB PDB Q12657 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@@H]([C@H](C(=O)O)O)(C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.