Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 35.484 Lower values reduce human off-target concern.
- Human E-value
- 5.54e-06
- Gut microbiome similarity
- 1.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 96.98 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MNQVAVVIGGGQTLGEFLCRGLAAEGYRVAVVDIQSEKASRVAQEINAEYGEGMAYGFGADATSEASVTALAHGVDEIFSRVDLLVYSAGIAKAAFISDFALGDFDRSLQVNLVGYFLCAREFSRLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVHSLMLGNLLKSPMFQSLLPQYATKLGIDESEVEQYYIDKVPLKRGCEYQDVLNVLMFYASPQASYCTGQSINVTGGQVMF
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
2- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
- GO:0016616 Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 128 | 144 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 128 | 144 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 4 | 21 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 4 | 21 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 220 | 240 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 220 | 240 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 80 | 91 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 80 | 91 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 154 | 173 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 154 | 173 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 141 | 169 | ProSitePatterns | PS00061 | Short-chain dehydrogenases/reductases family signature. |
| 141 | 169 | InterPro | IPR020904 | Short-chain dehydrogenase/reductase, conserved site |
| 2 | 258 | Gene3D | G3DSA:3.40.50.720 | - |
| 2 | 258 | SUPERFAMILY | SSF51735 | NAD(P)-binding Rossmann-fold domains |
| 2 | 258 | InterPro | IPR036291 | NAD(P)-binding domain superfamily |
| 134 | 142 | PRINTS | PR00080 | Short-chain dehydrogenase/reductase (SDR) superfamily signature |
| 134 | 142 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 80 | 91 | PRINTS | PR00080 | Short-chain dehydrogenase/reductase (SDR) superfamily signature |
| 154 | 173 | PRINTS | PR00080 | Short-chain dehydrogenase/reductase (SDR) superfamily signature |
| 3 | 197 | Pfam | PF00106 | short chain dehydrogenase |
| 3 | 197 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 2 | 256 | PANTHER | PTHR42760 | SHORT-CHAIN DEHYDROGENASES/REDUCTASES FAMILY MEMBER |
| 1 | 258 | CDD | cd05322 | SDH_SDR_c_like |
| 2 | 258 | FunFam | G3DSA:3.40.50.720:FF:000091 | Sorbitol-6-phosphate dehydrogenase |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3H1W1
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_02593
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 1HS RCSB PDB | A7IQH5 | 200.3 Da LogP -0.01 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](CSCCS(=O)(=O)O)O
|
|
| AAE RCSB PDB | A0A1E3M3N6 | 102.1 Da LogP 0.05 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CC(=O)CC(=O)O
|
|
| AOI RCSB PDB | P9WGT1 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H](C[C@@H]1CC[C@@H]3[C@@H]2CC[C@]4(…
|
|
| CHO RCSB PDB | P0AET8 | 449.6 Da LogP 3.59 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@@H]2[C@@]1(CC…
|
|
| EMO RCSB PDB | P16544 | 270.2 Da LogP 1.89 TPSA 94.8 | ✓ Ro5 | Alert |
Cc1cc2c(c(c1)O)C(=O)c3c(cc(cc3O)O)C2=O
|
|
| ISZ RCSB PDB | P16544 | 135.1 Da LogP 1.25 TPSA 66.2 | ✓ Ro5 | Alert |
[H]/N=N/C(=O)c1ccncc1
|
|
| QT8 RCSB PDB | A0A1E3M3N6 | 116.1 Da LogP 0.44 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCC(=O)CC(=O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC3824868 ZINC | 1.000 | 270.2 Da LogP 1.89 TPSA 94.8 | ✓ Ro5 | Alert |
Cc1cc(O)c2c(c1)C(=O)c1cc(O)cc(O)c1C2=O
|
| ZINC118912648 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@…
|
| ZINC118912649 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H…
|
| ZINC118912650 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@…
|
| ZINC118912651 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H…
|
| ZINC118913700 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C…
|
| ZINC118913701 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@…
|
| ZINC17654510 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@…
|
| ZINC1857777516 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@H]2[C@H]3[C…
|
| ZINC2060999620 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@…
|
| ZINC2060999621 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@…
|
| ZINC2060999622 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@…
|
| ZINC253497644 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C…
|
| ZINC253497645 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C…
|
| ZINC253497646 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[…
|
| ZINC253497647 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[…
|
| ZINC253608430 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@@H]2[C@@H]3[C…
|
| ZINC253615012 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[…
|
| ZINC253615013 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[…
|
| ZINC253615014 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[…
|
| ZINC253615015 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[…
|
| ZINC38144567 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@…
|
| ZINC40164193 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H…
|
| ZINC53683926 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@H]2[C@H]3[C@…
|
| ZINC61389426 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@@H]2[C@H]3[C@…
|
| ZINC61389432 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@@H]2[C@@H]3[C…
|
| ZINC80852657 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@@H]2[C@H]3[C@…
|
| ZINC8143774 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H…
|
| ZINC85426221 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@@H]2[C@@H]3[C…
|
| ZINC85426225 ZINC | 0.800 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@@H]2[C@H]3[C@…
|
| ZINC263583595 ZINC | 0.774 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@@H]2[C@@H]([C@H](O)C[C@H]3C[C@H](O)C…
|
| ZINC263583596 ZINC | 0.774 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@@H]2[C@@H]([C@H](O)C[C@@H]3C[C@H](O)…
|
| ZINC263583597 ZINC | 0.774 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@@H]2[C@H]([C@@H]3CC[C@H]([C@H](C)CCC…
|
| ZINC263583598 ZINC | 0.774 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@@H]2[C@H]([C@@H]3CC[C@H]([C@H](C)CCC…
|
| ZINC137420360 ZINC | 0.746 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H…
|
| ZINC141773506 ZINC | 0.746 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@…
|
| ZINC2382311551 ZINC | 0.746 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H…
|
| ZINC306145260 ZINC | 0.746 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[…
|
| ZINC306145261 ZINC | 0.746 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[…
|
| ZINC306145262 ZINC | 0.746 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C…
|
| ZINC306145263 ZINC | 0.746 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C…
|
| ZINC118914627 ZINC | 0.742 | 499.7 Da LogP 3.40 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCCS(=O)(=O)O)[C@H]1CC[C@H]2[C@@H…
|
| ZINC253534623 ZINC | 0.742 | 499.7 Da LogP 3.40 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCCS(=O)(=O)O)[C@@H]1CC[C@@H]2[C…
|
| ZINC253534624 ZINC | 0.742 | 499.7 Da LogP 3.40 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCCS(=O)(=O)O)[C@@H]1CC[C@@H]2[C…
|
| ZINC33650236 ZINC | 0.742 | 499.7 Da LogP 3.40 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCCS(=O)(=O)O)[C@H]1CC[C@H]2[C@H]…
|
| ZINC33650237 ZINC | 0.742 | 499.7 Da LogP 3.40 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCCS(=O)(=O)O)[C@H]1CC[C@@H]2[C@H…
|
| ZINC38324520 ZINC | 0.742 | 499.7 Da LogP 3.40 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCCS(=O)(=O)O)[C@H]1CC[C@@H]2[C@H…
|
| ZINC40164308 ZINC | 0.742 | 499.7 Da LogP 3.40 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCCS(=O)(=O)O)[C@H]1CC[C@H]2[C@@H…
|
| ZINC60292564 ZINC | 0.742 | 499.7 Da LogP 3.40 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCCS(=O)(=O)O)[C@H]1CC[C@@H]2[C@@…
|
| ZINC85345450 ZINC | 0.742 | 499.7 Da LogP 3.40 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCCS(=O)(=O)O)[C@H]1CC[C@@H]2[C@H…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.