Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 58.0 Lower values reduce human off-target concern.
- Human E-value
- 8.94e-10
- Gut microbiome similarity
- 1.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 97.05 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKIDLAGKVALVTASTAGIGFAIAKGLAESGAEVILNGRSEQSVNAAIARLQNEVPGAKARPAIADLSDADGAAQLLRAVTGVDILVNNAGIYGPQDFYATDDATWDNYWQTNVMSGVRLSRGLLPAMVSKGWGRVVFISSESARNIPADMIHYGVTKTAQLSLARGLAKYVAGSGVTVNSVLPGPTISDGFAEMLKDDVAKTGKSLEELAKAFVMTHRPSSVIQRAASVAEVANMVVYVCSPQASATSGAALRVDGGVVDDIL
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
No GO or EC annotations are currently loaded for this protein.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 21 | 28 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 9 | 20 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 1 | 259 | SUPERFAMILY | SSF51735 | NAD(P)-binding Rossmann-fold domains |
| 1 | 259 | InterPro | IPR036291 | NAD(P)-binding domain superfamily |
| 175 | 192 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 175 | 192 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 223 | 243 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 223 | 243 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 9 | 26 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 9 | 26 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 154 | 173 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 154 | 173 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 81 | 92 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 81 | 92 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 128 | 144 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 128 | 144 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 1 | 8 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 1 | 28 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 1 | 263 | Gene3D | G3DSA:3.40.50.720 | - |
| 8 | 194 | Pfam | PF00106 | short chain dehydrogenase |
| 8 | 194 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 29 | 264 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 262 | FunFam | G3DSA:3.40.50.720:FF:000084 | Short-chain dehydrogenase reductase |
| 10 | 256 | CDD | cd05233 | SDR_c |
| 81 | 92 | PRINTS | PR00080 | Short-chain dehydrogenase/reductase (SDR) superfamily signature |
| 134 | 142 | PRINTS | PR00080 | Short-chain dehydrogenase/reductase (SDR) superfamily signature |
| 134 | 142 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 154 | 173 | PRINTS | PR00080 | Short-chain dehydrogenase/reductase (SDR) superfamily signature |
| 4 | 260 | PANTHER | PTHR42879 | 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A6A8ECE2
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_02452
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 3HR RCSB PDB | D0VWQ0 | 104.1 Da LogP -0.16 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C[C@H](CC(=O)O)O
|
|
| 9G1 RCSB PDB | B1YU47 | 998.6 Da LogP -2.54 TPSA 476.1 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| AAE RCSB PDB | D0VWQ0 | 102.1 Da LogP 0.05 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CC(=O)CC(=O)O
|
|
| BUO RCSB PDB | G5EGA6 | 86.1 Da LogP 0.16 TPSA 34.1 | ✓ Ro5 | Alert |
CC(=O)C(=O)C
|
|
| DXX RCSB PDB | D0VWQ0 | 118.1 Da LogP -0.21 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
CC(C(=O)O)C(=O)O
|
|
| F3V RCSB PDB | A0QP46 | 73.1 Da LogP -0.47 TPSA 43.1 | ✓ Ro5 | ✓ Clean |
CC(=O)CN
|
|
| ISN RCSB PDB | G5EGA6 | 147.1 Da LogP 0.82 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
c1ccc2c(c1)C(=O)C(=O)N2
|
|
| MLA RCSB PDB | D0VWQ0 | 104.1 Da LogP -0.45 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(C(=O)O)C(=O)O
|
|
| TCE RCSB PDB | B2JE32 | 250.2 Da LogP 0.89 TPSA 111.9 | ✓ Ro5 | ✓ Clean |
C(CP(CCC(=O)O)CCC(=O)O)C(=O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC2517013 ZINC | 1.000 | 250.2 Da LogP 0.89 TPSA 111.9 | ✓ Ro5 | ✓ Clean |
O=C(O)CCP(CCC(=O)O)CCC(=O)O
|
| ZINC16974563 ZINC | 0.727 | 238.2 Da LogP 2.50 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccccc2C(=O)Nc2ccccc21
|
| ZINC100014196 ZINC | 0.667 | 262.3 Da LogP 2.81 TPSA 58.2 | ✓ Ro5 | Alert |
O=C1/C(=C2\Nc3ccccc3C2=O)Nc2ccccc21
|
| ZINC100513617 ZINC | 0.667 | 262.3 Da LogP 2.81 TPSA 58.2 | ✓ Ro5 | Alert |
O=C1/C(=C2/Nc3ccccc3C2=O)Nc2ccccc21
|
| ZINC1857776489 ZINC | 0.667 | 262.3 Da LogP 2.81 TPSA 58.2 | ✓ Ro5 | Alert |
O=C1C(=C2Nc3ccccc3C2=O)Nc2ccccc21
|
| ZINC3126818 ZINC | 0.667 | 210.2 Da LogP 3.00 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccccc2Nc2ccccc21
|
| ZINC32915988 ZINC | 0.667 | 262.3 Da LogP 2.50 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccccc2/C1=C1\C(=O)Nc2ccccc21
|
| ZINC34172946 ZINC | 0.667 | 262.3 Da LogP 2.50 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccccc2/C1=C1/C(=O)Nc2ccccc21
|
| ZINC45069786 ZINC | 0.667 | 271.3 Da LogP 4.59 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccccc2-c2ccccc2-c2ccccc21
|
| ZINC6117582 ZINC | 0.667 | 262.3 Da LogP 2.50 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccccc2C1=C1C(=O)Nc2ccccc21
|
| ZINC401273 ZINC | 0.652 | 238.2 Da LogP 2.50 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccccc2NC(=O)c2ccccc21
|
| ZINC100015416 ZINC | 0.643 | 262.3 Da LogP 2.66 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccccc2/C1=C1\Nc2ccccc2C1=O
|
| ZINC1857626905 ZINC | 0.643 | 262.3 Da LogP 2.66 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccccc2C1=C1Nc2ccccc2C1=O
|
| ZINC18825333 ZINC | 0.643 | 262.3 Da LogP 2.66 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccccc2/C1=C1/Nc2ccccc2C1=O
|
| ZINC3871401 ZINC | 0.620 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3871402 ZINC | 0.620 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC3871403 ZINC | 0.620 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3871404 ZINC | 0.620 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC4096223 ZINC | 0.620 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC12360002 ZINC | 0.608 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12360703 ZINC | 0.608 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12503599 ZINC | 0.608 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC16546165 ZINC | 0.608 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO[P@](=O)(O)OP(=O)(…
|
| ZINC31977053 ZINC | 0.608 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC4806433 ZINC | 0.608 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC53683898 ZINC | 0.608 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586019 ZINC | 0.608 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC8586020 ZINC | 0.608 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586021 ZINC | 0.608 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC8586022 ZINC | 0.608 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC238950253 ZINC | 0.606 | 744.4 Da LogP -2.90 TPSA 364.8 | 3 viol. | ✓ Clean |
NC(=O)c1ccc[n+]([C@@H]2O[C@H](CO[P@](=O)(O)O[P@…
|
| ZINC238950256 ZINC | 0.606 | 744.4 Da LogP -2.90 TPSA 364.8 | 3 viol. | ✓ Clean |
NC(=O)c1ccc[n+]([C@@H]2O[C@H](CO[P@](=O)(O)O[P@…
|
| ZINC238950259 ZINC | 0.606 | 744.4 Da LogP -2.90 TPSA 364.8 | 3 viol. | ✓ Clean |
NC(=O)c1ccc[n+]([C@@H]2O[C@H](CO[P@](=O)(O)O[P@…
|
| ZINC238950261 ZINC | 0.606 | 744.4 Da LogP -2.90 TPSA 364.8 | 3 viol. | ✓ Clean |
NC(=O)c1ccc[n+]([C@@H]2O[C@H](CO[P@](=O)(O)O[P@…
|
| ZINC117753192 ZINC | 0.600 | 203.2 Da LogP 1.65 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
C/C(O)=C1\C(=O)Nc2ccccc2C1=O
|
| ZINC257166 ZINC | 0.593 | 290.3 Da LogP 1.78 TPSA 82.9 | ✓ Ro5 | Alert |
O=C1Nc2ccccc2/C1=N\N=C1\C(=O)Nc2ccccc21
|
| ZINC85775 ZINC | 0.583 | 210.2 Da LogP 3.31 TPSA 41.1 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccccc2-c2ccccc2N1
|
| ZINC3023696 ZINC | 0.571 | 257.2 Da LogP -0.24 TPSA 104.4 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)C(=C2C(=O)Nc3ccccc32)C(=O)N1
|
| ZINC36610867 ZINC | 0.571 | 446.4 Da LogP 3.32 TPSA 116.4 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccccc2/C1=C1\C(=O)Nc2cc3c(cc21)NC(=O)/C3…
|
| ZINC16948211 ZINC | 0.567 | 223.2 Da LogP 2.49 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccc(-c3ccccc3)cc2C1=O
|
| ZINC35086915 ZINC | 0.567 | 223.2 Da LogP 2.49 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2cc(-c3ccccc3)ccc2C1=O
|
| ZINC16946250 ZINC | 0.563 | 257.7 Da LogP 3.14 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
O=C1Nc2ccc(-c3ccccc3Cl)cc2C1=O
|
| ZINC13546016 ZINC | 0.560 | 276.3 Da LogP 0.49 TPSA 110.1 | ✓ Ro5 | ✓ Clean |
C[C@H](O)CC(=O)O[C@@H](C)CC(=O)O[C@@H](C)CC(=O)O
|
| ZINC13546018 ZINC | 0.560 | 276.3 Da LogP 0.49 TPSA 110.1 | ✓ Ro5 | ✓ Clean |
C[C@H](O)CC(=O)O[C@H](C)CC(=O)O[C@@H](C)CC(=O)O
|
| ZINC257400894 ZINC | 0.560 | 276.3 Da LogP 0.49 TPSA 110.1 | ✓ Ro5 | ✓ Clean |
C[C@H](O)CC(=O)O[C@H](C)CC(=O)O[C@H](C)CC(=O)O
|
| ZINC257400895 ZINC | 0.560 | 276.3 Da LogP 0.49 TPSA 110.1 | ✓ Ro5 | ✓ Clean |
C[C@H](O)CC(=O)O[C@@H](C)CC(=O)O[C@H](C)CC(=O)O
|
| ZINC31475423 ZINC | 0.560 | 434.3 Da LogP -2.99 TPSA 238.4 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO[P@@](=O)(O)OC(=O)…
|
| ZINC1532515 ZINC | 0.557 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@H](O…
|
| ZINC1571045 ZINC | 0.557 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC3977897 ZINC | 0.557 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](COP(=O)(O)O)[C@@H](O…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.