KpKP13 Protein target profile
Isopenicillin N synthase domain-containing protein
Accession: KP13_02447
Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 0.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 88.88 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MTAVKHAFTELPTIDIRDLAGDDLARRQAVADAIGRAAREVGFFYITGHGIDPALIAGVREAAKQIFALPMEEKMNYYIGHSKSHKGYVPEGEEIYGSGKPDHKEAFDIGFQAADDHPLVLAGTPLIGANEWPDLPDFRARVLAYYDAVFALGHRLFDAFALALGLPEGYFKPMVTCPPAKLRLIHYPFDASVEDVPGIGAHTDYECFTLLLADQPGLEVLNEESVWIDAPPVKNAAGEEAFVINIGDMLEVLSAGTFVATAHRVRKVPQERYSFPLFFACDYHTLIRPLPTFLAAGEAGEYQELSIGEHMWSQALQTYRYLREKVNRGELQLPERARGTNTFGHLKKQAQQKTP
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
2- GO:0102276 Catalysis of the reaction: 2-oxoglutarate(2-) + O2 + 2 H+ = ethene + 3 carbon dioxide + H2O.
- GO:0046872 Binding to a metal ion.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 8 | 321 | SUPERFAMILY | SSF51197 | Clavaminate synthase-like |
| 178 | 281 | ProSiteProfiles | PS51471 | Fe(2+) 2-oxoglutarate dioxygenase domain profile. |
| 178 | 281 | InterPro | IPR005123 | Oxoglutarate/iron-dependent dioxygenase |
| 1 | 325 | Gene3D | G3DSA:2.60.120.330 | - |
| 1 | 325 | InterPro | IPR027443 | Isopenicillin N synthase-like superfamily |
| 34 | 51 | PRINTS | PR00682 | Isopenicillin N synthase signature |
| 269 | 287 | PRINTS | PR00682 | Isopenicillin N synthase signature |
| 155 | 171 | PRINTS | PR00682 | Isopenicillin N synthase signature |
| 242 | 268 | PRINTS | PR00682 | Isopenicillin N synthase signature |
| 182 | 279 | Pfam | PF03171 | 2OG-Fe(II) oxygenase superfamily |
| 182 | 279 | InterPro | IPR044861 | Isopenicillin N synthase-like, Fe(2+) 2OG dioxygenase domain |
| 11 | 134 | Pfam | PF14226 | non-haem dioxygenase in morphine synthesis N-terminal |
| 11 | 134 | InterPro | IPR026992 | Non-haem dioxygenase N-terminal domain |
| 9 | 303 | PANTHER | PTHR10209 | OXIDOREDUCTASE, 2OG-FE II OXYGENASE FAMILY PROTEIN |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0C7KE07
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_02447
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| ACC RCSB PDB | P05326 | 382.5 Da LogP -1.80 TPSA 160.4 | 1 viol. | ✓ Clean |
CSC[C@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)CCC[C@@H](…
|
|
| ACV RCSB PDB | P05326 | 363.4 Da LogP -0.79 TPSA 158.8 | 1 viol. | ✓ Clean |
CC(C)[C@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)CCC[C@@H…
|
|
| ACW RCSB PDB | P05326 | 375.4 Da LogP -0.65 TPSA 158.8 | 1 viol. | ✓ Clean |
CC1(CC1)[C@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)CCC[C…
|
|
| AKG RCSB PDB | Q96323 | 146.1 Da LogP -0.50 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
C(CC(=O)O)C(=O)C(=O)O
|
|
| ASV RCSB PDB | P05326 | 347.4 Da LogP -1.26 TPSA 158.8 | 1 viol. | ✓ Clean |
C=C[C@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)CCC[C@@H](…
|
|
| BCV RCSB PDB | P05326 | 361.4 Da LogP -1.04 TPSA 158.8 | 1 viol. | ✓ Clean |
C1CC1[C@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)CCC[C@@H…
|
|
| DH2 RCSB PDB | Q96323 | 304.3 Da LogP 1.19 TPSA 127.5 | ✓ Ro5 | Alert |
c1cc(c(cc1[C@H]2[C@@H](C(=O)c3c(cc(cc3O2)O)O)O)…
|
|
| DQH RCSB PDB | Q96323 | 304.3 Da LogP 1.19 TPSA 127.5 | ✓ Ro5 | Alert |
c1cc(c(cc1[C@@H]2[C@H](C(=O)c3c(cc(cc3O2)O)O)O)…
|
|
| FYU RCSB PDB | Q7RYZ9 | 140.1 Da LogP -1.12 TPSA 82.8 | ✓ Ro5 | ✓ Clean |
C1=C(C(=O)NC(=O)N1)C=O
|
|
| HCV RCSB PDB | P05326 | 377.5 Da LogP -0.40 TPSA 158.8 | 1 viol. | ✓ Clean |
CC(C)[C@H](C(=O)O)NC(=O)[C@H](CCS)NC(=O)CCC[C@@…
|
|
| HMU RCSB PDB | Q7RYZ9 | 142.1 Da LogP -1.44 TPSA 86.0 | ✓ Ro5 | ✓ Clean |
C1=C(C(=O)NC(=O)N1)CO
|
|
| HYO RCSB PDB | Q6EZB3 | 289.4 Da LogP 1.93 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CN1[C@@H]2CC[C@H]1CC(C2)OC(=O)[C@H](CO)c3ccccc3
|
|
| IP1 RCSB PDB | P05326 | 359.4 Da LogP -0.80 TPSA 150.0 | ✓ Ro5 | ✓ Clean |
CC1([C@@H](N2[C@H](S1)[C@@H](C2=O)NC(=O)CCC[C@@…
|
|
| KKA RCSB PDB | P05326 | 278.3 Da LogP -0.54 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C(C[C@@H](C(=O)O)N)CC(=O)N[C@@H](CCS)C(=O)O
|
|
| M11 RCSB PDB | P05326 | 378.4 Da LogP 0.02 TPSA 156.0 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H](C(=O)O)OC(=O)[C@H]([C@H](C)S)NC(=O)C…
|
|
| M2W RCSB PDB | P05326 | 379.4 Da LogP -1.41 TPSA 168.0 | 1 viol. | ✓ Clean |
C[C@@H]([C@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)CCC[C…
|
|
| M8F RCSB PDB | P05326 | 395.5 Da LogP -0.69 TPSA 158.8 | 1 viol. | ✓ Clean |
CSCC[C@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)CCC[C@@H]…
|
|
| M9F RCSB PDB | P05326 | 395.5 Da LogP -0.70 TPSA 158.8 | 1 viol. | ✓ Clean |
CC([C@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)CCC[C@@H](…
|
|
| NAR RCSB PDB | Q96323 | 272.3 Da LogP 2.51 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1[C@@H]2CC(=O)c3c(cc(cc3O2)O)O)O
|
|
| OGA RCSB PDB | Q6EZB3 | 147.1 Da LogP -1.73 TPSA 103.7 | ✓ Ro5 | ✓ Clean |
C(C(=O)O)NC(=O)C(=O)O
|
|
| OXY RCSB PDB | P05326 | 32.0 Da LogP 0.07 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
O=O
|
|
| QUE RCSB PDB | Q96323 | 302.2 Da LogP 1.99 TPSA 131.4 | ✓ Ro5 | Alert |
c1cc(c(cc1C2=C(C(=O)c3c(cc(cc3O2)O)O)O)O)O
|
|
| SIN RCSB PDB | Q96323 | 118.1 Da LogP -0.06 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(CC(=O)O)C(=O)O
|
|
| TDR RCSB PDB | Q7RYZ9 | 126.1 Da LogP -0.63 TPSA 65.7 | ✓ Ro5 | ✓ Clean |
CC1=CNC(=O)NC1=O
|
|
| V10 RCSB PDB | P05326 | 382.5 Da LogP -0.66 TPSA 156.0 | ✓ Ro5 | ✓ Clean |
CSC[C@@H](C(=O)O)OC(=O)[C@H](CS)NC(=O)CCC[C@@H]…
|
|
| VB1 RCSB PDB | P05326 | 349.4 Da LogP -1.04 TPSA 158.8 | 1 viol. | ✓ Clean |
CC[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)CCC[C@@H](…
|
|
| VVO RCSB PDB | P05326 | 66.9 Da LogP -0.12 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
O=[V+2]
|
|
| W2X RCSB PDB | P05326 | 392.4 Da LogP -0.88 TPSA 176.2 | 1 viol. | ✓ Clean |
C[C@H](CO)[C@H](C(=O)O)OC(=O)[C@H](C(=C)S)NC(=O…
|
|
| W6X RCSB PDB | P05326 | 112.1 Da LogP 1.14 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC(=O)C(F)(F)F
|
|
| W6Z RCSB PDB | P05326 | 130.1 Da LogP 0.25 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
CC(C(F)(F)F)(O)O
|
|
| WT4 RCSB PDB | P05326 | 395.5 Da LogP -0.69 TPSA 158.8 | 1 viol. | ✓ Clean |
CSC[C@H](C(=O)O)NC(=O)[C@H](CCS)NC(=O)CCC[C@@H]…
|
|
| YT3 RCSB PDB | B8M9K5 | 88.9 Da LogP -0.00 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
[Y+3]
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100009278 ZINC | 1.000 | 289.4 Da LogP 1.93 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CN1[C@H]2CC[C@@H]1C[C@H](OC(=O)[C@@H](CO)c1cccc…
|
| ZINC100009280 ZINC | 1.000 | 289.4 Da LogP 1.93 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CN1[C@H]2CC[C@@H]1C[C@H](OC(=O)[C@H](CO)c1ccccc…
|
| ZINC100016634 ZINC | 1.000 | 289.4 Da LogP 1.93 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CN1[C@@H]2CC[C@@H]1CC(OC(=O)[C@@H](CO)c1ccccc1)…
|
| ZINC100016638 ZINC | 1.000 | 289.4 Da LogP 1.93 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CN1[C@H]2CC[C@H]1CC(OC(=O)[C@@H](CO)c1ccccc1)C2
|
| ZINC100018343 ZINC | 1.000 | 304.3 Da LogP 1.19 TPSA 127.5 | ✓ Ro5 | Alert |
O=C1c2c(O)cc(O)cc2O[C@H](c2ccc(O)c(O)c2)[C@H]1O
|
| ZINC100042072 ZINC | 1.000 | 289.4 Da LogP 1.93 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CN1[C@@H]2CC[C@@H]1CC(OC(=O)[C@H](CO)c1ccccc1)C2
|
| ZINC100042076 ZINC | 1.000 | 289.4 Da LogP 1.93 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CN1[C@H]2CC[C@H]1CC(OC(=O)[C@H](CO)c1ccccc1)C2
|
| ZINC100068360 ZINC | 1.000 | 289.4 Da LogP 1.93 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CN1[C@H]2CC[C@@H]1C[C@@H](OC(=O)[C@H](CO)c1cccc…
|
| ZINC100271918 ZINC | 1.000 | 289.4 Da LogP 1.93 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CN1[C@H]2CC[C@@H]1C[C@@H](OC(=O)[C@@H](CO)c1ccc…
|
| ZINC105076 ZINC | 1.000 | 304.3 Da LogP 1.19 TPSA 127.5 | ✓ Ro5 | Alert |
O=C1c2c(O)cc(O)cc2O[C@@H](c2ccc(O)c(O)c2)[C@H]1O
|
| ZINC105082 ZINC | 1.000 | 304.3 Da LogP 1.19 TPSA 127.5 | ✓ Ro5 | Alert |
O=C1c2c(O)cc(O)cc2O[C@@H](c2ccc(O)c(O)c2)[C@@H]…
|
| ZINC105086 ZINC | 1.000 | 304.3 Da LogP 1.19 TPSA 127.5 | ✓ Ro5 | Alert |
O=C1c2c(O)cc(O)cc2O[C@H](c2ccc(O)c(O)c2)[C@@H]1O
|
| ZINC12358661 ZINC | 1.000 | 289.4 Da LogP 1.93 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CN1[C@H]2CC[C@@H]1CC(OC(=O)[C@@H](CO)c1ccccc1)C2
|
| ZINC12503745 ZINC | 1.000 | 359.4 Da LogP -0.80 TPSA 150.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)CCC[C@@H](N)C(=O)O)C(…
|
| ZINC156701 ZINC | 1.000 | 272.3 Da LogP 2.51 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
O=C1C[C@@H](c2ccc(O)cc2)Oc2cc(O)cc(O)c21
|
| ZINC1704128 ZINC | 1.000 | 359.4 Da LogP -0.80 TPSA 150.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@H](NC(=O)CCC[C@H](N)C(=O)O)C(=O…
|
| ZINC1785 ZINC | 1.000 | 272.3 Da LogP 2.51 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
O=C1C[C@H](c2ccc(O)cc2)Oc2cc(O)cc(O)c21
|
| ZINC3869685 ZINC | 1.000 | 302.2 Da LogP 1.99 TPSA 131.4 | ✓ Ro5 | Alert |
O=c1c(O)c(-c2ccc(O)c(O)c2)oc2cc(O)cc(O)c12
|
| ZINC3873037 ZINC | 1.000 | 363.4 Da LogP -0.79 TPSA 158.8 | 1 viol. | ✓ Clean |
CC(C)[C@@H](NC(=O)[C@H](CS)NC(=O)CCC[C@H](N)C(=…
|
| ZINC4096831 ZINC | 1.000 | 359.4 Da LogP -0.80 TPSA 150.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)CCC[C@H](N)C(=O)O)C(=…
|
| ZINC4097194 ZINC | 1.000 | 359.4 Da LogP -0.80 TPSA 150.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)CCC[C@@H](N)C(=O)O)C(…
|
| ZINC4995219 ZINC | 1.000 | 359.4 Da LogP -0.80 TPSA 150.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]2[C@H](NC(=O)CCC[C@H](N)C(=O)O)C(=O…
|
| ZINC4995221 ZINC | 1.000 | 359.4 Da LogP -0.80 TPSA 150.0 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]2[C@H](NC(=O)CCC[C@H](N)C(=O)O)C(=…
|
| ZINC56 ZINC | 1.000 | 289.4 Da LogP 1.93 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CN1[C@H]2CC[C@@H]1CC(OC(=O)[C@H](CO)c1ccccc1)C2
|
| ZINC4935 ZINC | 0.816 | 256.3 Da LogP 2.80 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
O=C1C[C@H](c2ccccc2)Oc2cc(O)cc(O)c21
|
| ZINC73693 ZINC | 0.816 | 256.3 Da LogP 2.80 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
O=C1C[C@@H](c2ccccc2)Oc2cc(O)cc(O)c21
|
| ZINC263615759 ZINC | 0.810 | 287.4 Da LogP 3.35 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
CC[C@H](C(=O)O[C@@H]1C[C@@H]2CC[C@H](C1)N2C)c1c…
|
| ZINC263615760 ZINC | 0.810 | 287.4 Da LogP 3.35 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
CC[C@@H](C(=O)O[C@@H]1C[C@@H]2CC[C@H](C1)N2C)c1…
|
| ZINC263615761 ZINC | 0.810 | 287.4 Da LogP 3.35 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
CC[C@H](C(=O)O[C@H]1C[C@@H]2CC[C@H](C1)N2C)c1cc…
|
| ZINC263615762 ZINC | 0.810 | 287.4 Da LogP 3.35 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
CC[C@@H](C(=O)O[C@H]1C[C@@H]2CC[C@H](C1)N2C)c1c…
|
| ZINC57476742 ZINC | 0.810 | 287.4 Da LogP 3.35 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
CC[C@H](C(=O)OC1C[C@@H]2CC[C@H](C1)N2C)c1ccccc1
|
| ZINC57476743 ZINC | 0.810 | 287.4 Da LogP 3.35 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
CC[C@@H](C(=O)OC1C[C@@H]2CC[C@H](C1)N2C)c1ccccc1
|
| ZINC14728393 ZINC | 0.806 | 288.3 Da LogP 2.22 TPSA 107.2 | ✓ Ro5 | ✓ Clean |
O=C1C[C@@H](c2cc(O)cc(O)c2)Oc2cc(O)cc(O)c21
|
| ZINC100524246 ZINC | 0.795 | 317.4 Da LogP 2.71 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CC(C)N1[C@H]2CC[C@H]1CC(OC(=O)[C@@H](CO)c1ccccc…
|
| ZINC103575717 ZINC | 0.795 | 317.4 Da LogP 2.71 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CC(C)N1[C@H]2CC[C@@H]1C[C@H](OC(=O)[C@@H](CO)c1…
|
| ZINC103575723 ZINC | 0.795 | 317.4 Da LogP 2.71 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CC(C)N1[C@H]2CC[C@@H]1C[C@H](OC(=O)[C@H](CO)c1c…
|
| ZINC106372492 ZINC | 0.795 | 317.4 Da LogP 2.71 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
CC(C)N1[C@H]2CC[C@H]1CC(OC(=O)[C@H](CO)c1ccccc1…
|
| ZINC13517387 ZINC | 0.795 | 288.3 Da LogP 1.48 TPSA 107.2 | ✓ Ro5 | ✓ Clean |
O=C1c2c(O)cc(O)cc2O[C@H](c2ccc(O)cc2)[C@H]1O
|
| ZINC13517390 ZINC | 0.795 | 288.3 Da LogP 1.48 TPSA 107.2 | ✓ Ro5 | ✓ Clean |
O=C1c2c(O)cc(O)cc2O[C@@H](c2ccc(O)cc2)[C@@H]1O
|
| ZINC1573791 ZINC | 0.795 | 288.3 Da LogP 1.48 TPSA 107.2 | ✓ Ro5 | ✓ Clean |
O=C1c2c(O)cc(O)cc2O[C@@H](c2ccc(O)cc2)[C@H]1O
|
| ZINC58116 ZINC | 0.795 | 288.3 Da LogP 2.22 TPSA 107.2 | ✓ Ro5 | Alert |
O=C1C[C@H](c2ccc(O)c(O)c2)Oc2cc(O)cc(O)c21
|
| ZINC58117 ZINC | 0.795 | 288.3 Da LogP 2.22 TPSA 107.2 | ✓ Ro5 | Alert |
O=C1C[C@@H](c2ccc(O)c(O)c2)Oc2cc(O)cc(O)c21
|
| ZINC87666880 ZINC | 0.795 | 288.3 Da LogP 1.48 TPSA 107.2 | ✓ Ro5 | ✓ Clean |
O=C1c2c(O)cc(O)cc2O[C@H](c2ccc(O)cc2)[C@@H]1O
|
| ZINC3869768 ZINC | 0.784 | 286.2 Da LogP 2.28 TPSA 111.1 | ✓ Ro5 | ✓ Clean |
O=c1c(O)c(-c2ccc(O)cc2)oc2cc(O)cc(O)c12
|
| ZINC4348965 ZINC | 0.775 | 270.3 Da LogP 3.11 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
Cc1cc(O)c2c(c1)O[C@H](c1ccc(O)cc1)CC2=O
|
| ZINC4348970 ZINC | 0.775 | 270.3 Da LogP 3.11 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
Cc1cc(O)c2c(c1)O[C@@H](c1ccc(O)cc1)CC2=O
|
| ZINC4349582 ZINC | 0.769 | 300.3 Da LogP 2.59 TPSA 111.1 | ✓ Ro5 | Alert |
Cc1c(-c2ccc(O)c(O)c2)oc2cc(O)cc(O)c2c1=O
|
| ZINC2146973 ZINC | 0.762 | 286.3 Da LogP 2.81 TPSA 76.0 | ✓ Ro5 | ✓ Clean |
COc1ccc([C@@H]2CC(=O)c3c(O)cc(O)cc3O2)cc1
|
| ZINC895707 ZINC | 0.762 | 286.3 Da LogP 2.81 TPSA 76.0 | ✓ Ro5 | ✓ Clean |
COc1ccc([C@H]2CC(=O)c3c(O)cc(O)cc3O2)cc1
|
| ZINC3874317 ZINC | 0.757 | 318.2 Da LogP 1.69 TPSA 151.6 | 1 viol. | Alert |
O=c1c(O)c(-c2cc(O)c(O)c(O)c2)oc2cc(O)cc(O)c12
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.