KpKP13 Protein target profile

tRNA (guanine-N(1)-)-methyltransferase

Accession: KP13_02423

Gene: AHE43141.1 trmD 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GU39
Length 255
Pocket druggability (P2Rank · AlphaFold DB model) 0.085
Direct ligand evidence 0 177 total records
Functional annotation 1 EC 4 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
10.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
98.039 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
95.46 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.085
Structure A0A0H3GU39
Pocket Pocket 1
Druggability (FPocket) 0.183
Structure A0A0H3GU39
Pocket Pocket 12
ColabFold model
P2Rank 0.054 · Pocket 1
FPocket 0.108 · Pocket 17
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 473 / 4744 genomes with a hit
Prevalence 10.0%

Sequence

Primary amino-acid sequence viewer.

MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIESWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHEASATEDSFADGLLDCPHYTRPEVLEEMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENLALTEEQAKLLAEFKTEHAQQQHKHDGQA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0052906 Catalysis of the reaction: S-adenosyl-L-methionine + guanine(37) in tRNA = N(1)-methylguanine(37) in tRNA + S-adenosyl-L-homocysteine.
  • GO:0008033 The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0002939 The process whereby a guanine in tRNA is methylated at position N1 of the guanine.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

20 records
Show feature table
Start End DB Term Name
166 255 Gene3D G3DSA:1.10.1270.20 tRNA(m1g37)methyltransferase, domain 2
166 255 InterPro IPR023148 tRNA (guanine-N(1)-)-methyltransferase, C-terminal domain superfamily
166 245 FunFam G3DSA:1.10.1270.20:FF:000001 tRNA (guanine-N(1)-)-methyltransferase
1 165 FunFam G3DSA:3.40.1280.10:FF:000001 tRNA (guanine-N(1)-)-methyltransferase
1 245 PANTHER PTHR46417 TRNA (GUANINE-N(1)-)-METHYLTRANSFERASE
1 245 InterPro IPR002649 tRNA (guanine-N1-)-methyltransferase TrmD
1 247 SUPERFAMILY SSF75217 alpha/beta knot
1 247 InterPro IPR029028 Alpha/beta knot methyltransferases
1 253 PIRSF PIRSF000386 tRNA_mtase
1 253 InterPro IPR002649 tRNA (guanine-N1-)-methyltransferase TrmD
3 221 CDD cd18080 TrmD-like
3 221 InterPro IPR002649 tRNA (guanine-N1-)-methyltransferase TrmD
1 255 Hamap MF_00605 tRNA (guanine-N(1)-)-methyltransferase [trmD].
1 255 InterPro IPR002649 tRNA (guanine-N1-)-methyltransferase TrmD
1 165 Gene3D G3DSA:3.40.1280.10 -
1 165 InterPro IPR029026 tRNA (guanine-N1-)-methyltransferase, N-terminal
23 221 Pfam PF01746 tRNA (Guanine-1)-methyltransferase
23 221 InterPro IPR016009 tRNA methyltransferase TRMD/TRM10-type domain
1 235 NCBIfam TIGR00088 tRNA (guanosine(37)-N1)-methyltransferase TrmD
1 235 InterPro IPR002649 tRNA (guanine-N1-)-methyltransferase TrmD

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.085
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.022
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.01
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:113-113
UniProt: Binding site:133-138
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GU39
AlphaFold DB full sequence Viewing
ColabFold KP13_02423
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

177 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 127 records from similar proteins
Structural ligands 89 0 loaded crystals
Measured bioactivity 38 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
21W PDB via homolog 394.5 Da · LogP 1.93 · TPSA 115.6 Open detail RCSB PDB
21X PDB via homolog Detail RCSB PDB
22L PDB via homolog Detail RCSB PDB
4F9 PDB via homolog Detail RCSB PDB
4FD PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
21W RCSB PDB P43912 394.5 Da LogP 1.93 TPSA 115.6 ✓ Ro5 ✓ Clean c1cc(ccc1CNCc2[nH]ccn2)CNC(=O)c3csc4c3C(=O)NC=N4
21X RCSB PDB P43912 314.4 Da LogP 1.37 TPSA 100.9 ✓ Ro5 ✓ Clean c1cc(ccc1CN)CNC(=O)c2csc3c2C(=O)NC=N3
22L RCSB PDB P43912 228.3 Da LogP 2.65 TPSA 45.8 ✓ Ro5 ✓ Clean c1ccc(cc1)c2csc3c2C(=O)NC=N3
4F9 RCSB PDB P43912 145.2 Da LogP 1.47 TPSA 41.6 ✓ Ro5 ✓ Clean c1cnccc1c2cnc[nH]2
4FD RCSB PDB P43912 227.3 Da LogP 1.79 TPSA 68.0 ✓ Ro5 ✓ Clean c1ccc(cc1)CNc2ccc(cn2)C(=O)N
4FG RCSB PDB P43912 137.1 Da LogP -0.24 TPSA 82.0 ✓ Ro5 ✓ Clean c1cc(ncc1C(=O)N)N
4FL RCSB PDB P43912 145.2 Da LogP 1.47 TPSA 41.6 ✓ Ro5 ✓ Clean c1cnccc1c2[nH]ccn2
4FM RCSB PDB P43912 252.7 Da LogP 1.24 TPSA 94.0 ✓ Ro5 ✓ Clean c1cc(ccc1CNC(=O)c2c(non2)N)Cl
4FN RCSB PDB P43912 433.6 Da LogP 4.99 TPSA 84.2 ✓ Ro5 ✓ Clean CC(C)(C)c1cccc(c1)C(=O)NCC2(CCCCC2)NC(=O)c3cccc…
4FV RCSB PDB P43912 212.2 Da LogP -0.70 TPSA 114.3 ✓ Ro5 ✓ Clean C1C[C@@H](C[C@@H]1NC(=O)c2c(non2)N)O
4FX RCSB PDB P43912 257.3 Da LogP 1.80 TPSA 77.2 ✓ Ro5 ✓ Clean COc1ccccc1CNc2ccc(cn2)C(=O)N
4G0 RCSB PDB P43912 270.3 Da LogP 1.86 TPSA 71.2 ✓ Ro5 ✓ Clean CN(C)c1cccc(c1)CNc2ccc(cn2)C(=O)N
4G1 RCSB PDB P43912 377.4 Da LogP 3.61 TPSA 84.2 ✓ Ro5 ✓ Clean Cc1cccc(c1)C(=O)NCC2(CCCC2)NC(=O)c3cccc4c3con4
4G3 RCSB PDB P43912 243.3 Da LogP 1.50 TPSA 88.2 ✓ Ro5 ✓ Clean c1cc(cc(c1)O)CNc2ccc(cn2)C(=O)N
4G4 RCSB PDB P43912 270.3 Da LogP 1.86 TPSA 71.2 ✓ Ro5 ✓ Clean CN(C)c1ccccc1CNc2ccc(cn2)C(=O)N
4GM RCSB PDB P43912 243.3 Da LogP 1.50 TPSA 88.2 ✓ Ro5 Alert c1ccc(c(c1)CNc2ccc(cn2)C(=O)N)O
4GN RCSB PDB P43912 219.3 Da LogP 1.78 TPSA 68.0 ✓ Ro5 ✓ Clean c1cc(ncc1C(=O)N)NCC2CCCC2
4GS RCSB PDB P43912 211.2 Da LogP -0.87 TPSA 106.1 ✓ Ro5 ✓ Clean C1CNCCC1NC(=O)c2c(non2)N
4GT RCSB PDB P43912 221.3 Da LogP 0.51 TPSA 106.9 ✓ Ro5 ✓ Clean c1c(c(nc(n1)NC2CCCC2)N)C(=O)N
4GX RCSB PDB P43912 288.3 Da LogP 0.00 TPSA 101.4 ✓ Ro5 ✓ Clean c1ccnc(c1)CN2CCN(CC2)C(=O)c3c(non3)N
4GY RCSB PDB P43912 224.3 Da LogP 0.96 TPSA 94.0 ✓ Ro5 ✓ Clean C1CCC(CC1)CNC(=O)c2c(non2)N
4GZ RCSB PDB P43912 394.5 Da LogP 3.67 TPSA 97.1 ✓ Ro5 ✓ Clean Cc1cccc(c1)C(=O)NCCC2(CCCCC2)CNc3ccc(cn3)C(=O)N
4H1 RCSB PDB P43912 262.4 Da LogP 1.36 TPSA 94.0 ✓ Ro5 ✓ Clean c1cc(ncc1C(=O)N)NC[C@@H]2CCC[C@@H](C2)CN
4H3 RCSB PDB P43912 251.3 Da LogP -0.28 TPSA 108.5 ✓ Ro5 ✓ Clean c1cc(ncc1C(=O)N)N[C@@H]2C[C@@H]([C@H](C2)O)CO
4H4 RCSB PDB P43912 323.3 Da LogP -0.41 TPSA 154.2 ✓ Ro5 ✓ Clean c1cc(ccc1[C@H]2C[C@@H]2NC(=O)c3c(non3)N)S(=O)(=…
4H6 RCSB PDB P43912 312.4 Da LogP 1.63 TPSA 80.5 ✓ Ro5 ✓ Clean c1ccc(c(c1)CNc2ccc(cn2)C(=O)N)N3CCOCC3
4H7 RCSB PDB P43912 325.4 Da LogP 1.54 TPSA 74.5 ✓ Ro5 ✓ Clean CN1CCN(CC1)c2ccccc2CNc3ccc(cn3)C(=O)N
4H8 RCSB PDB P43912 223.3 Da LogP 0.62 TPSA 106.9 ✓ Ro5 ✓ Clean CC(C)(C)CNc1ncc(c(n1)N)C(=O)N
4H9 RCSB PDB P43912 218.2 Da LogP 0.56 TPSA 83.0 ✓ Ro5 ✓ Clean COc1ccc(cc1)C(=O)n2c(ncn2)N
4HQ RCSB PDB P43912 211.2 Da LogP -0.96 TPSA 88.5 ✓ Ro5 ✓ Clean CN1CCN(CC1)C(=O)c2c(non2)N
58G RCSB PDB P43912 281.4 Da LogP 2.93 TPSA 68.0 ✓ Ro5 ✓ Clean c1ccc(cc1)[C@H]2CC[C@H](C2)Nc3ccc(cn3)C(=O)N
5OB RCSB PDB B1MDI3 148.2 Da LogP 1.57 TPSA 37.9 ✓ Ro5 ✓ Clean COc1ccc2c(c1)[nH]cn2
6GU RCSB PDB B1MDI3 169.6 Da LogP 0.59 TPSA 80.5 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)c(nc(n2)N)Cl
6SD RCSB PDB B1MDI3 189.2 Da LogP 1.67 TPSA 63.9 ✓ Ro5 ✓ Clean COc1ccc(cc1)c2cc([nH]n2)N
97T RCSB PDB B1MDI3 161.2 Da LogP 2.05 TPSA 46.3 ✓ Ro5 ✓ Clean c1ccc(c(c1)c2ccno2)O
9WO RCSB PDB Q02RL6 386.5 Da LogP 3.35 TPSA 89.7 ✓ Ro5 ✓ Clean c1ccc2c(c1)cc([nH]2)C(=O)N[C@H]3CCCN(C3)c4cc(n[…
ABV RCSB PDB B1MDI3 150.2 Da LogP 1.88 TPSA 38.9 ✓ Ro5 ✓ Clean c1ccc2c(c1)nc(s2)N
ADE RCSB PDB B1MDI3 135.1 Da LogP -0.06 TPSA 80.5 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)c(ncn2)N
ADN RCSB PDB P43912 267.2 Da LogP -1.98 TPSA 139.5 ✓ Ro5 ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
EFW RCSB PDB P43912 221.3 Da LogP 0.51 TPSA 88.2 ✓ Ro5 ✓ Clean c1cc(ncc1C(=O)N)N[C@@H]2CC[C@H](C2)O
EFY RCSB PDB P43912 419.5 Da LogP 4.60 TPSA 84.2 ✓ Ro5 ✓ Clean CC(C)(C)c1cccc(c1)C(=O)NCC2(CCCC2)NC(=O)c3cccc4…
FBB RCSB PDB B1MDI3 168.2 Da LogP 2.02 TPSA 38.9 ✓ Ro5 ✓ Clean c1cc2c(cc1F)sc(n2)N
FLC RCSB PDB P43912 189.1 Da LogP -5.25 TPSA 140.6 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
GOJ RCSB PDB B1MDI3 140.1 Da LogP 0.59 TPSA 55.0 ✓ Ro5 ✓ Clean CCOC(=O)c1c[nH]nc1
J9N RCSB PDB B1MDI3 165.2 Da LogP 1.72 TPSA 54.7 ✓ Ro5 ✓ Clean c1cc(sc1)c2cc([nH]n2)N
J9Q RCSB PDB B1MDI3 160.2 Da LogP 1.92 TPSA 52.0 ✓ Ro5 ✓ Clean c1ccc(c(c1)c2cnco2)N
J9T RCSB PDB B1MDI3 152.2 Da LogP 0.45 TPSA 65.2 ✓ Ro5 ✓ Clean COC(=O)c1ccnc(c1)N
J9W RCSB PDB B1MDI3 163.1 Da LogP 0.48 TPSA 63.1 ✓ Ro5 ✓ Clean c1ccc2c(c1)C(=O)NC(=O)O2
JA5 RCSB PDB B1MDI3 211.2 Da LogP 1.51 TPSA 62.3 ✓ Ro5 ✓ Clean COC(=O)c1cc2cc(sc2[nH]1)CO
JA8 RCSB PDB B1MDI3 229.1 Da LogP 2.64 TPSA 38.9 ✓ Ro5 ✓ Clean c1cc2c(cc1Br)nc(s2)N
JAB RCSB PDB B1MDI3 128.2 Da LogP 0.31 TPSA 52.0 ✓ Ro5 ✓ Clean c1cnoc1C(=S)N
JAE RCSB PDB B1MDI3 150.2 Da LogP 1.88 TPSA 38.9 ✓ Ro5 ✓ Clean c1cc2c(cc1N)scn2
JAH RCSB PDB B1MDI3 184.2 Da LogP 2.21 TPSA 38.9 ✓ Ro5 ✓ Clean c1ccc(cc1)c2ccc(cn2)CN
JAW RCSB PDB B1MDI3 160.2 Da LogP 1.27 TPSA 58.9 ✓ Ro5 ✓ Clean c1cc2c(cc[nH]2)cc1C(=O)N
JB5 RCSB PDB B1MDI3 145.2 Da LogP 1.21 TPSA 51.8 ✓ Ro5 ✓ Clean c1cc2c(cc1N)nccn2
JB8 RCSB PDB B1MDI3 161.0 Da LogP -0.15 TPSA 56.2 ✓ Ro5 ✓ Clean B(c1ccc2cc[nH]c2c1)(O)O
JBH RCSB PDB B1MDI3 148.2 Da LogP 0.94 TPSA 44.6 ✓ Ro5 ✓ Clean c1ccc2c(c1)C(NC=N2)O
JBK RCSB PDB B1MDI3 154.1 Da LogP 0.88 TPSA 89.4 ✓ Ro5 ✓ Clean c1cc(c(c(c1)O)N)[N+](=O)[O-]
JBN RCSB PDB B1MDI3 112.1 Da LogP -0.23 TPSA 69.1 ✓ Ro5 ✓ Clean c1cnoc1C(=O)N
JBQ RCSB PDB B1MDI3 166.2 Da LogP 1.08 TPSA 44.6 ✓ Ro5 ✓ Clean c1cc2c(c(c1)F)C(NC=N2)O
JBZ RCSB PDB B1MDI3 209.2 Da LogP 2.00 TPSA 59.4 ✓ Ro5 ✓ Clean COc1ccc2c(c1)sc(n2)C(=O)O
JCE RCSB PDB B1MDI3 289.3 Da LogP 3.06 TPSA 72.5 ✓ Ro5 ✓ Clean c1ccnc(c1)Cn2ccc3c2cc(cc3)c4cc(n[nH]4)N
JCH RCSB PDB B1MDI3 318.4 Da LogP 3.67 TPSA 68.9 ✓ Ro5 ✓ Clean COc1ccc(cc1)Cn2ccc3c2cc(cc3)c4cc([nH]n4)N
JCK RCSB PDB B1MDI3 396.5 Da LogP 4.13 TPSA 86.7 ✓ Ro5 ✓ Clean c1cc(ccc1Cn2ccc3c2cc(cc3)c4c(c([nH]n4)N)C#N)CN5…
JCQ RCSB PDB B1MDI3 232.2 Da LogP 1.78 TPSA 64.2 ✓ Ro5 ✓ Clean COc1cccc(c1)COC(=O)c2c[nH]nc2
JCZ RCSB PDB B1MDI3 198.2 Da LogP 2.14 TPSA 70.5 ✓ Ro5 ✓ Clean c1cc(cc2c1cc[nH]2)c3cc([nH]n3)N
JD2 RCSB PDB B1MDI3 314.4 Da LogP 2.93 TPSA 96.3 ✓ Ro5 ✓ Clean c1ccnc(c1)Cn2ccc3c2cc(cc3)c4c(c([nH]n4)N)C#N
JD8 RCSB PDB B1MDI3 334.4 Da LogP 2.97 TPSA 86.7 ✓ Ro5 ✓ Clean CN1CCCCC1Cn2ccc3c2cc(cc3)c4c(c([nH]n4)N)C#N
JDE RCSB PDB B1MDI3 309.3 Da LogP 2.84 TPSA 77.1 ✓ Ro5 ✓ Clean COc1cc(cc(c1)c2cccnc2)COC(=O)c3c[nH]nc3
JDH RCSB PDB B1MDI3 425.5 Da LogP 3.28 TPSA 89.9 ✓ Ro5 ✓ Clean CN1CCN(CC1)Cc2ccc(cc2)Cn3ccc4c3cc(cc4)c5c(c([nH…
JDK RCSB PDB B1MDI3 385.5 Da LogP 4.65 TPSA 62.9 ✓ Ro5 ✓ Clean c1cc(ccc1Cn2ccc3c2cc(cc3)c4cc([nH]n4)N)CN5CCCCC5
JDN RCSB PDB B1MDI3 161.0 Da LogP -0.15 TPSA 56.2 ✓ Ro5 ✓ Clean B(c1ccc2c(c1)cc[nH]2)(O)O
JDQ RCSB PDB B1MDI3 288.4 Da LogP 3.66 TPSA 59.6 ✓ Ro5 ✓ Clean c1ccc(cc1)Cn2ccc3c2cc(cc3)c4cc([nH]n4)N
JE8 RCSB PDB B1MDI3 334.4 Da LogP 2.83 TPSA 86.7 ✓ Ro5 ✓ Clean CN1CCCC(C1)Cn2ccc3c2cc(cc3)c4c(c([nH]n4)N)C#N
JEB RCSB PDB B1MDI3 314.4 Da LogP 2.93 TPSA 96.3 ✓ Ro5 ✓ Clean c1cc(cnc1)Cn2ccc3c2cc(cc3)c4c(c([nH]n4)N)C#N
JEE RCSB PDB B1MDI3 412.5 Da LogP 3.37 TPSA 95.9 ✓ Ro5 ✓ Clean c1cc(ccc1Cn2ccc3c2cc(cc3)c4c(c([nH]n4)N)C#N)CN5…
JEH RCSB PDB B1MDI3 453.6 Da LogP 4.06 TPSA 89.9 ✓ Ro5 ✓ Clean CC(C)N1CCN(CC1)Cc2ccc(cc2)Cn3ccc4c3cc(cc4)c5c(c…
JEK RCSB PDB B1MDI3 410.5 Da LogP 4.52 TPSA 86.7 ✓ Ro5 ✓ Clean c1cc(ccc1Cn2ccc3c2cc(cc3)c4c(c([nH]n4)N)C#N)CN5…
JEQ RCSB PDB B1MDI3 410.5 Da LogP 4.40 TPSA 86.7 ✓ Ro5 ✓ Clean c1ccc(cc1)CN2CCCC(C2)Cn3ccc4c3cc(cc4)c5c(c([nH]…
JET RCSB PDB B1MDI3 290.3 Da LogP 1.32 TPSA 90.5 ✓ Ro5 ✓ Clean COC(=O)COc1cccc(c1)COC(=O)c2c[nH]nc2
JEW RCSB PDB B1MDI3 313.4 Da LogP 3.53 TPSA 83.4 ✓ Ro5 ✓ Clean c1ccc(c(c1)Cn2ccc3c2cc(cc3)c4cc([nH]n4)N)C#N
JF5 RCSB PDB B1MDI3 202.2 Da LogP 1.77 TPSA 55.0 ✓ Ro5 ✓ Clean c1ccc(cc1)COC(=O)c2c[nH]nc2
JF8 RCSB PDB B1MDI3 223.2 Da LogP 2.01 TPSA 94.3 ✓ Ro5 ✓ Clean c1cc(cc2c1cc[nH]2)c3c(c([nH]n3)N)C#N
JFB RCSB PDB B1MDI3 314.4 Da LogP 2.93 TPSA 96.3 ✓ Ro5 ✓ Clean c1cc(cc2c1ccn2Cc3ccncc3)c4c(c([nH]n4)N)C#N
JFE RCSB PDB B1MDI3 318.4 Da LogP 3.67 TPSA 68.9 ✓ Ro5 ✓ Clean COc1cccc(c1)Cn2ccc3c2cc(cc3)c4cc([nH]n4)N
JFH RCSB PDB B1MDI3 371.5 Da LogP 4.26 TPSA 62.9 ✓ Ro5 ✓ Clean c1cc(ccc1Cn2ccc3c2cc(cc3)c4cc([nH]n4)N)CN5CCCC5
JFT RCSB PDB B1MDI3 348.8 Da LogP 3.58 TPSA 96.3 ✓ Ro5 ✓ Clean c1cc(cnc1)Cn2cc(c3c2cc(cc3)c4c(c(n[nH]4)N)C#N)Cl
JQB RCSB PDB B1MDI3 330.4 Da LogP 2.63 TPSA 116.5 ✓ Ro5 ✓ Clean c1cc(c(nc1)O)Cn2ccc3c2cc(cc3)c4c(c([nH]n4)N)C#N
SFG RCSB PDB Q02RL6 381.4 Da LogP -2.06 TPSA 208.7 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.