KpKP13 Protein target profile

Inosine-5'-monophosphate dehydrogenase

Accession: KP13_00869

Gene: guaB AHE43232.1 3D evidence: AlphaFold DB model + ColabFold model UniProt W8UE92
Length 488
Pocket druggability (P2Rank · AlphaFold DB model) 0.952
Direct ligand evidence 0 83 total records
Functional annotation 1 EC 8 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
50.413 Lower values reduce human off-target concern.
Human E-value
6.61e-27
Gut microbiome similarity
47.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
98.156 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
91.49 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.952
Structure W8UE92
Pocket Pocket 1
Druggability (FPocket) 0.501
Structure W8UE92
Pocket Pocket 33
ColabFold model
P2Rank 0.956 · Pocket 1
FPocket 0.498 · Pocket 36
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 2269 / 4744 genomes with a hit
Prevalence 47.8%

Sequence

Primary amino-acid sequence viewer.

MLRIAKEALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIPMLSAAMDTVTEARLAIALAQEGGIGFIHKNMSIERQAEEVRRVKKHESGVVTDPQTVLPTTTLREVKELTERNGFAGYPVVTEENELVGIITGRDVRFVTDLNQPVSVYMTPKERLVTVREGESREVVFAKMHEKRVEKALVVDESFHLRGMITVKDFQKAERKPNACKDEQGRLRVGAAVGAGAGNEERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKYPDLQIIGGNVATGAGARALAEAGCSAVKVGIGPGSICTTRIVTGVGVPQITAVSDAVEALEGTGIPVIADGGIRFSGDIAKAIAAGAAAVMVGSMLAGTEESPGEIELYQGRSYKSYRGMGSLGAMSKGSSDRYFQSDNAADKLVPEGIEGRVAYKGRLKEIIHQQMGGLRSCMGLTGCGTIDLLRTKAEFVRISGAGIQESHVHDVTITKESPNYRLGS

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 8 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

8
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0003938 Catalysis of the reaction: inosine 5'-phosphate + NAD+ + H2O = xanthosine 5'-phosphate + NADH + H+.
  • GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
  • GO:0006164 The chemical reactions and pathways resulting in the formation of a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
  • GO:0046872 Binding to a metal ion.
  • GO:0000166 Binding to a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
  • GO:0006177 The chemical reactions and pathways resulting in the formation of GMP, guanosine monophosphate.
  • GO:0006183 The chemical reactions and pathways resulting in the formation of GTP, guanosine triphosphate.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

33 records
Show feature table
Start End DB Term Name
8 486 Hamap MF_01964 Inosine-5'-monophosphate dehydrogenase [guaB].
8 486 InterPro IPR005990 Inosine-5'-monophosphate dehydrogenase
6 481 PANTHER PTHR11911 INOSINE-5-MONOPHOSPHATE DEHYDROGENASE RELATED
6 481 InterPro IPR005990 Inosine-5'-monophosphate dehydrogenase
94 203 SUPERFAMILY SSF54631 CBS-domain pair
94 203 InterPro IPR046342 CBS domain superfamily
7 473 SMART SM01240 IMPDH_2
8 454 NCBIfam TIGR01302 IMP dehydrogenase
8 454 InterPro IPR005990 Inosine-5'-monophosphate dehydrogenase
158 206 SMART SM00116 cbs_1
158 206 InterPro IPR000644 CBS domain
96 144 SMART SM00116 cbs_1
96 144 InterPro IPR000644 CBS domain
8 462 CDD cd00381 IMPDH
8 462 InterPro IPR001093 IMP dehydrogenase/GMP reductase
295 307 ProSitePatterns PS00487 IMP dehydrogenase / GMP reductase signature.
295 307 InterPro IPR015875 IMP dehydrogenase / GMP reductase, conserved site
153 202 Pfam PF00571 CBS domain
153 202 InterPro IPR000644 CBS domain
95 140 Pfam PF00571 CBS domain
95 140 InterPro IPR000644 CBS domain
1 487 PIRSF PIRSF000130 IMPDH
1 487 InterPro IPR005990 Inosine-5'-monophosphate dehydrogenase
1 486 Gene3D G3DSA:3.20.20.70 Aldolase class I
1 486 InterPro IPR013785 Aldolase-type TIM barrel
93 149 ProSiteProfiles PS51371 CBS domain profile.
93 149 InterPro IPR000644 CBS domain
1 486 FunFam G3DSA:3.20.20.70:FF:000003 GMP reductase
153 214 ProSiteProfiles PS51371 CBS domain profile.
153 214 InterPro IPR000644 CBS domain
8 473 Pfam PF00478 IMP dehydrogenase / GMP reductase domain
8 473 InterPro IPR001093 IMP dehydrogenase/GMP reductase
1 477 SUPERFAMILY SSF51412 Inosine monophosphate dehydrogenase (IMPDH)

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.952
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.47
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.245
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.208
Likely same site as FPocket 31 5.0 Å 13 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.15
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #33
0.501
Show in viewer
Surrounding area
Pocket 2 FPocket #31
0.31 Unusual size
Likely same site as P2Rank 4 5.0 Å 13 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_W8UE92
AlphaFold DB full sequence Viewing
ColabFold KP13_00869
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

83 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 33 records from similar proteins
Structural ligands 14 0 loaded crystals
Measured bioactivity 19 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
2EY PDB via homolog 366.8 Da · LogP 3.90 · TPSA 72.8 Open detail RCSB PDB
2F1 PDB via homolog Detail RCSB PDB
2F2 PDB via homolog Detail RCSB PDB
8L1 PDB via homolog Detail RCSB PDB
8L4 PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
2EY RCSB PDB A0A6L8P2U9 366.8 Da LogP 3.90 TPSA 72.8 ✓ Ro5 ✓ Clean C[C@H](c1cn(nn1)c2ccc(cc2)Cl)OC3=CC(=O)Nc4c3ccc…
2F1 RCSB PDB Q0P9J4 373.3 Da LogP 5.54 TPSA 41.1 1 viol. ✓ Clean CC(=C)c1cccc(c1)C(C)(C)NC(=O)Nc2ccc(cc2)Br
2F2 RCSB PDB Q0P9J4 46.1 Da LogP 0.26 TPSA 9.2 ✓ Ro5 ✓ Clean COC
8L1 RCSB PDB A0A6L8P2U9 496.9 Da LogP 6.74 TPSA 86.6 1 viol. ✓ Clean C/C(=N\O)/c1cccc(c1)C(C)(C)NC(=O)Nc2ccc(c(c2)c3…
8L4 RCSB PDB A0A6L8P2U9 346.8 Da LogP 3.70 TPSA 97.2 ✓ Ro5 ✓ Clean [H]/N=C(/c1cccc(c1)C(C)(C)NC(=O)Nc2ccc(cc2)Cl)\…
8LA RCSB PDB A0A6L8P2U9 477.0 Da LogP 3.25 TPSA 120.3 ✓ Ro5 ✓ Clean CC(=C)c1cccc(c1)C(C)(C)NC(=O)Nc2ccc(c(c2)O[C@@H…
C91 RCSB PDB Q0P9J4 378.4 Da LogP 4.89 TPSA 59.8 ✓ Ro5 ✓ Clean c1ccc2cc(ccc2c1)NC(=O)Cn3c4ccccc4nc3c5ccccn5
IMP RCSB PDB P0C0H6 348.2 Da LogP -2.15 TPSA 180.0 ✓ Ro5 ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)COP(=O)(O…
JQS RCSB PDB A0A6L8P2U9 366.2 Da LogP -2.07 TPSA 209.9 1 viol. ✓ Clean c1nc(c(n1[C@H]2[C@@H]([C@@H]([C@H](O2)COP(=O)(O…
MLI RCSB PDB A0A6L8P2U9 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
MOA RCSB PDB Q9KTW3 320.3 Da LogP 2.73 TPSA 93.1 ✓ Ro5 ✓ Clean Cc1c2c(c(c(c1OC)C\C=C(/C)\CCC(=O)O)O)C(=O)OC2
NAJ RCSB PDB Q9KTW3 663.4 Da LogP -4.86 TPSA 325.2 3 viol. ✓ Clean c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)COP(…
TAR RCSB PDB A0A6L8P2U9 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@H]([C@@H](C(=O)O)O)(C(=O)O)O
XMP RCSB PDB Q9KTW3 365.2 Da LogP -3.44 TPSA 201.2 1 viol. ✓ Clean c1[nH+]c2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)COP(=…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.