KpKP13 Protein target profile

Cysteine synthase A

Accession: KP13_03554

Gene: AHE43360.1 cysK 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GWF8
Length 323
Pocket druggability (P2Rank · AlphaFold DB model) 0.922
Direct ligand evidence 0 70 total records
Functional annotation 1 EC 2 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
52.427 Lower values reduce human off-target concern.
Human E-value
9.21e-24
Gut microbiome similarity
59.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
43.689 Higher values support similarity to known essential genes.
DEG E-value
2.3500000000000002e-70 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
96.72 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.922
Structure A0A0H3GWF8
Pocket Pocket 1
Druggability (FPocket) 0.433
Structure A0A0H3GWF8
Pocket Pocket 9
ColabFold model
P2Rank 0.916 · Pocket 1
FPocket 0.581 · Pocket 4
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 2804 / 4744 genomes with a hit
Prevalence 59.1%

Sequence

Primary amino-acid sequence viewer.

MSKIFEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAEEIVASNPEQFLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFISGVGTGGTLTGVSRYIKNTKGKKDLITVAVEPTDSPVIAQALAGEELKPGPHKIQGIGAGFIPGNLDLKLVDKVIGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDEAFTNKNIVVILPSSGERYLSTALFADLFTEKELQQ

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 2 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

2
  • GO:0006535 OBSOLETE. The chemical reactions and pathways resulting in the formation of cysteine from L- serine.
  • GO:0004124 Catalysis of the reaction: O3-acetyl-L-serine + hydrogen sulfide = L-cysteine + acetate.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

17 records
Show feature table
Start End DB Term Name
13 308 CDD cd01561 CBS_like
3 317 SUPERFAMILY SSF53686 Tryptophan synthase beta subunit-like PLP-dependent enzymes
3 317 InterPro IPR036052 Tryptophan synthase beta chain-like, PALP domain superfamily
9 312 NCBIfam TIGR01139 cysteine synthase A
9 312 InterPro IPR005859 Cysteine synthase CysK
10 300 Pfam PF00291 Pyridoxal-phosphate dependent enzyme
10 300 InterPro IPR001926 Tryptophan synthase beta chain-like, PALP domain
12 308 Gene3D G3DSA:3.40.50.1100 -
12 308 InterPro IPR036052 Tryptophan synthase beta chain-like, PALP domain superfamily
10 318 PANTHER PTHR10314 CYSTATHIONINE BETA-SYNTHASE
31 49 ProSitePatterns PS00901 Cysteine synthase/cystathionine beta-synthase P-phosphate attachment site.
31 49 InterPro IPR001216 Cysteine synthase/cystathionine beta-synthase, pyridoxal-phosphate attachment site
43 145 Gene3D G3DSA:3.40.50.1100 -
43 145 InterPro IPR036052 Tryptophan synthase beta chain-like, PALP domain superfamily
10 312 NCBIfam TIGR01136 cysteine synthase
10 312 InterPro IPR005856 Cysteine synthase
124 308 FunFam G3DSA:3.40.50.1100:FF:000009 Cysteine synthase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.922
Likely same site as FPocket 9 4.1 Å 23 shared residues 77% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.039
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #9
0.433 Unusual size
Likely same site as P2Rank 1 4.1 Å 23 shared residues 77% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:177-181
UniProt: Binding site:273-273
UniProt: Binding site:72-72
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GWF8
AlphaFold DB full sequence Viewing
ColabFold KP13_03554
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

70 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 20 records from similar proteins
Structural ligands 5 0 loaded crystals
Measured bioactivity 15 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
0JO PDB via homolog 316.2 Da · LogP 0.72 · TPSA 149.5 Open detail RCSB PDB
AA5 PDB via homolog Detail RCSB PDB
AWH PDB via homolog Detail RCSB PDB
OAS PDB via homolog Detail RCSB PDB
PDA PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
0JO RCSB PDB P45040 316.2 Da LogP 0.72 TPSA 149.5 ✓ Ro5 ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)/C=N/C(=C)C(=O)O)O
AA5 RCSB PDB P47998 378.3 Da LogP 1.33 TPSA 149.5 ✓ Ro5 ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)C=N[C@@H](CCSC)C(=O)O)O
AWH RCSB PDB P9WP55 412.4 Da LogP 3.08 TPSA 116.5 ✓ Ro5 ✓ Clean CN\1C(=O)/C(=C/c2ccccc2OCC(=O)O)/S/C1=N\c3cccc(…
OAS RCSB PDB P45040 147.1 Da LogP -1.04 TPSA 89.6 ✓ Ro5 ✓ Clean CC(=O)OC[C@@H](C(=O)O)N
PDA RCSB PDB P9WP55 320.2 Da LogP 0.27 TPSA 149.2 ✓ Ro5 ✓ Clean Cc1c(c(c(cn1)COP(=O)(O)O)CNC(C)C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.