KpKP13 Protein target profile

putative adenine-specific methylase

Accession: KP13_01039

Gene: AHE43433.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GVU0
Length 334
Pocket druggability (P2Rank · AlphaFold DB model) 0.765
Direct ligand evidence 0 51 total records
Functional annotation 1 EC 10 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
29.004 Lower values reduce human off-target concern.
Human E-value
3.21e-14
Gut microbiome similarity
3.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
60.596 Higher values support similarity to known essential genes.
DEG E-value
1.86e-142 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
92.33 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.765
Structure A0A0H3GVU0
Pocket Pocket 1
Druggability (FPocket) 0.957
Structure A0A0H3GVU0
Pocket Pocket 1
ColabFold model
P2Rank 0.778 · Pocket 1
FPocket 0.911 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 177 / 4744 genomes with a hit
Prevalence 3.7%

Sequence

Primary amino-acid sequence viewer.

MLIYRRLHGTLAAEFIAECALEDVVDKIFVDEAVNELHTIQDMLRWAVSRFSAANIWYGHGTDNPWDEAVQLVLPSLYLPLDIPEDMRTARLTSSEKHRIVERVIRRVNERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGELINNQFAGLINHKPQHILDMCTGSGCIAIACAYAFPEAEVDAVDISPDALAVAEHNVESHGLIHHVTPIRSDLFRDLPKLQYDLIVTNPPYVDEEDMADLPEEYEHEPVLGLASGSDGLKLTRRILGNAPDYLSDDGILICEVGNSMVHLMEQYPDVPFTWLEFDNGGDGVFMLTKQQLIDARAHFGIYKD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 10 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

10
  • GO:0009007 Catalysis of the reaction: S-adenosyl-L-methionine + DNA adenine = S-adenosyl-L-homocysteine + DNA 6-methylaminopurine.
  • GO:0008168 Catalysis of the transfer of a methyl group to an acceptor molecule.
  • GO:0003676 Binding to a nucleic acid.
  • GO:0032775 OBSOLETE. The covalent transfer of a methyl group to N-6 of adenine in a DNA molecule.
  • GO:0006479 The addition of a methyl group to a protein amino acid. A methyl group is derived from methane by the removal of a hydrogen atom.
  • GO:0032259 The process in which a methyl group is covalently attached to a molecule.
  • GO:0008276 Catalysis of the transfer of a methyl group (CH3-) to a protein.
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
  • GO:0036009 Catalysis of the reaction: L-glutaminyl-[protein] + S-adenosyl-L-methionine = N(5)-methyl-L-glutaminyl-[protein] + S-adenosyl-L-homocysteine + H+.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

22 records
Show feature table
Start End DB Term Name
38 128 Gene3D G3DSA:1.10.8.10 -
26 334 PANTHER PTHR47806 50S RIBOSOMAL PROTEIN L3 GLUTAMINE METHYLTRANSFERASE
26 334 InterPro IPR017127 Ribosomal protein L3-specific, glutamine-N5-methyltransferase
129 303 Gene3D G3DSA:3.40.50.150 Vaccinia Virus protein VP39
129 303 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
129 303 FunFam G3DSA:3.40.50.150:FF:000042 50S ribosomal protein L3 glutamine methyltransferase
37 319 NCBIfam TIGR03533 50S ribosomal protein L3 N(5)-glutamine methyltransferase
37 319 InterPro IPR017127 Ribosomal protein L3-specific, glutamine-N5-methyltransferase
39 317 SUPERFAMILY SSF53335 S-adenosyl-L-methionine-dependent methyltransferases
39 317 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
155 239 Pfam PF05175 Methyltransferase small domain
155 239 InterPro IPR007848 Methyltransferase small domain
22 331 PIRSF PIRSF037167 Mtase_YfcB
22 331 InterPro IPR017127 Ribosomal protein L3-specific, glutamine-N5-methyltransferase
30 324 Hamap MF_02125 50S ribosomal protein L3 glutamine methyltransferase [prmB].
30 324 InterPro IPR017127 Ribosomal protein L3-specific, glutamine-N5-methyltransferase
228 234 ProSitePatterns PS00092 N-6 Adenine-specific DNA methylases signature.
228 234 InterPro IPR002052 DNA methylase, N-6 adenine-specific, conserved site
39 326 NCBIfam TIGR00536 HemK family protein methyltransferase
39 326 InterPro IPR004556 Methyltransferase HemK-like
38 128 FunFam G3DSA:1.10.8.10:FF:000022 50S ribosomal protein L3 glutamine methyltransferase
160 234 CDD cd02440 AdoMet_MTases

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.765
Likely same site as FPocket 1 2.0 Å 25 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.377
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.009
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.957 Unusual size
Likely same site as P2Rank 1 2.0 Å 25 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GVU0
AlphaFold DB full sequence Viewing
ColabFold KP13_01039
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

51 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 1 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
MEQ PDB via homolog 160.2 Da · LogP -1.08 · TPSA 92.4 Open detail RCSB PDB
ZINC1529737 ZINC proposed compound · Tanimoto 0.714 Detail ZINC
ZINC2384790 ZINC proposed compound · Tanimoto 0.714 Detail ZINC
ZINC2560745 ZINC proposed compound · Tanimoto 0.714 Detail ZINC
ZINC2560989 ZINC proposed compound · Tanimoto 0.714 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
MEQ RCSB PDB Q9WYV8 160.2 Da LogP -1.08 TPSA 92.4 ✓ Ro5 ✓ Clean CNC(=O)CC[C@@H](C(=O)O)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.