Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 29.004 Lower values reduce human off-target concern.
- Human E-value
- 3.21e-14
- Gut microbiome similarity
- 3.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 60.596 Higher values support similarity to known essential genes.
- DEG E-value
- 1.86e-142 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 92.33 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MLIYRRLHGTLAAEFIAECALEDVVDKIFVDEAVNELHTIQDMLRWAVSRFSAANIWYGHGTDNPWDEAVQLVLPSLYLPLDIPEDMRTARLTSSEKHRIVERVIRRVNERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGELINNQFAGLINHKPQHILDMCTGSGCIAIACAYAFPEAEVDAVDISPDALAVAEHNVESHGLIHHVTPIRSDLFRDLPKLQYDLIVTNPPYVDEEDMADLPEEYEHEPVLGLASGSDGLKLTRRILGNAPDYLSDDGILICEVGNSMVHLMEQYPDVPFTWLEFDNGGDGVFMLTKQQLIDARAHFGIYKD
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
10- GO:0009007 Catalysis of the reaction: S-adenosyl-L-methionine + DNA adenine = S-adenosyl-L-homocysteine + DNA 6-methylaminopurine.
- GO:0008168 Catalysis of the transfer of a methyl group to an acceptor molecule.
- GO:0003676 Binding to a nucleic acid.
- GO:0032775 OBSOLETE. The covalent transfer of a methyl group to N-6 of adenine in a DNA molecule.
- GO:0006479 The addition of a methyl group to a protein amino acid. A methyl group is derived from methane by the removal of a hydrogen atom.
- GO:0032259 The process in which a methyl group is covalently attached to a molecule.
- GO:0008276 Catalysis of the transfer of a methyl group (CH3-) to a protein.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
- GO:0036009 Catalysis of the reaction: L-glutaminyl-[protein] + S-adenosyl-L-methionine = N(5)-methyl-L-glutaminyl-[protein] + S-adenosyl-L-homocysteine + H+.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 38 | 128 | Gene3D | G3DSA:1.10.8.10 | - |
| 26 | 334 | PANTHER | PTHR47806 | 50S RIBOSOMAL PROTEIN L3 GLUTAMINE METHYLTRANSFERASE |
| 26 | 334 | InterPro | IPR017127 | Ribosomal protein L3-specific, glutamine-N5-methyltransferase |
| 129 | 303 | Gene3D | G3DSA:3.40.50.150 | Vaccinia Virus protein VP39 |
| 129 | 303 | InterPro | IPR029063 | S-adenosyl-L-methionine-dependent methyltransferase superfamily |
| 129 | 303 | FunFam | G3DSA:3.40.50.150:FF:000042 | 50S ribosomal protein L3 glutamine methyltransferase |
| 37 | 319 | NCBIfam | TIGR03533 | 50S ribosomal protein L3 N(5)-glutamine methyltransferase |
| 37 | 319 | InterPro | IPR017127 | Ribosomal protein L3-specific, glutamine-N5-methyltransferase |
| 39 | 317 | SUPERFAMILY | SSF53335 | S-adenosyl-L-methionine-dependent methyltransferases |
| 39 | 317 | InterPro | IPR029063 | S-adenosyl-L-methionine-dependent methyltransferase superfamily |
| 155 | 239 | Pfam | PF05175 | Methyltransferase small domain |
| 155 | 239 | InterPro | IPR007848 | Methyltransferase small domain |
| 22 | 331 | PIRSF | PIRSF037167 | Mtase_YfcB |
| 22 | 331 | InterPro | IPR017127 | Ribosomal protein L3-specific, glutamine-N5-methyltransferase |
| 30 | 324 | Hamap | MF_02125 | 50S ribosomal protein L3 glutamine methyltransferase [prmB]. |
| 30 | 324 | InterPro | IPR017127 | Ribosomal protein L3-specific, glutamine-N5-methyltransferase |
| 228 | 234 | ProSitePatterns | PS00092 | N-6 Adenine-specific DNA methylases signature. |
| 228 | 234 | InterPro | IPR002052 | DNA methylase, N-6 adenine-specific, conserved site |
| 39 | 326 | NCBIfam | TIGR00536 | HemK family protein methyltransferase |
| 39 | 326 | InterPro | IPR004556 | Methyltransferase HemK-like |
| 38 | 128 | FunFam | G3DSA:1.10.8.10:FF:000022 | 50S ribosomal protein L3 glutamine methyltransferase |
| 160 | 234 | CDD | cd02440 | AdoMet_MTases |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GVU0
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_01039
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1529737 ZINC | 0.714 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC2384790 ZINC | 0.714 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC2560745 ZINC | 0.714 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC2560989 ZINC | 0.714 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC2390999 ZINC | 0.655 | 275.3 Da LogP -1.99 TPSA 172.8 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC2516115 ZINC | 0.613 | 246.3 Da LogP -0.60 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC13514803 ZINC | 0.606 | 347.3 Da LogP -1.88 TPSA 196.1 | 1 viol. | ✓ Clean |
C[C@H](NC(=O)CC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=…
|
| ZINC1576202 ZINC | 0.600 | 204.2 Da LogP -1.62 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)NCC(=O)O)C(=O)O
|
| ZINC3995565 ZINC | 0.600 | 204.2 Da LogP -1.62 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)NCC(=O)O)C(=O)O
|
| ZINC2504764 ZINC | 0.594 | 232.2 Da LogP -0.84 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC3055005 ZINC | 0.591 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC3055007 ZINC | 0.591 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC3055010 ZINC | 0.591 | 204.2 Da LogP -0.63 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC2391099 ZINC | 0.586 | 274.3 Da LogP -2.59 TPSA 178.6 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)O
|
| ZINC1608689 ZINC | 0.576 | 202.3 Da LogP 0.09 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCCNC(=O)CC[C@H](N)C(=O)O
|
| ZINC2045835 ZINC | 0.576 | 202.3 Da LogP 0.09 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCCNC(=O)CC[C@@H](N)C(=O)O
|
| ZINC2384788 ZINC | 0.576 | 260.3 Da LogP -0.21 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC12496578 ZINC | 0.571 | 275.3 Da LogP -2.12 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
C[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC2556600 ZINC | 0.567 | 217.2 Da LogP -1.83 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
C[C@H](NC(=O)[C@@H](N)CCC(N)=O)C(=O)O
|
| ZINC1555366 ZINC | 0.565 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1555367 ZINC | 0.565 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1555369 ZINC | 0.565 | 232.3 Da LogP 0.15 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1720127 ZINC | 0.565 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCC[C@H](N)C(=O)O)C(=O)O
|
| ZINC1720128 ZINC | 0.565 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1720130 ZINC | 0.565 | 218.3 Da LogP -0.24 TPSA 126.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC13507519 ZINC | 0.563 | 234.2 Da LogP -2.26 TPSA 150.0 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CO)C(=O)O)C(=O)O
|
| ZINC1576203 ZINC | 0.563 | 261.2 Da LogP -2.50 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)NCC(=O)NCC(=O)O)C(=O)O
|
| ZINC2516116 ZINC | 0.563 | 275.3 Da LogP -1.12 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC4545887 ZINC | 0.563 | 275.3 Da LogP -1.12 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC(=O)CC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC4545888 ZINC | 0.563 | 275.3 Da LogP -1.12 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)NCCCC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC4545889 ZINC | 0.563 | 275.3 Da LogP -1.12 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCNC(=O)CC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC1581634 ZINC | 0.552 | 203.2 Da LogP -2.22 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@H](N)C(=O)NCC(=O)O
|
| ZINC5500823 ZINC | 0.552 | 203.2 Da LogP -2.22 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@@H](N)C(=O)NCC(=O)O
|
| ZINC2242694 ZINC | 0.545 | 276.2 Da LogP -1.39 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC2547582 ZINC | 0.545 | 276.2 Da LogP -1.39 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC3870040 ZINC | 0.545 | 250.3 Da LogP -1.32 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CS)C(=O)O)C(=O)O
|
| ZINC3870041 ZINC | 0.545 | 250.3 Da LogP -1.32 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@H](CS)C(=O)O)C(=O)O
|
| ZINC3870042 ZINC | 0.545 | 250.3 Da LogP -1.32 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@@H](CS)C(=O)O)C(=O)O
|
| ZINC3870043 ZINC | 0.545 | 250.3 Da LogP -1.32 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@H](CS)C(=O)O)C(=O)O
|
| ZINC3872193 ZINC | 0.545 | 240.2 Da LogP -1.86 TPSA 146.8 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)NCS(=O)(=O)O)C(=O)O
|
| ZINC4096970 ZINC | 0.545 | 405.4 Da LogP -2.04 TPSA 233.4 | 1 viol. | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CCC(=O)N[C@@H](CCC(=O)O)…
|
| ZINC4545890 ZINC | 0.545 | 276.2 Da LogP -1.39 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC4545891 ZINC | 0.545 | 276.2 Da LogP -1.39 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC2560992 ZINC | 0.531 | 275.3 Da LogP -1.99 TPSA 172.8 | ✓ Ro5 | ✓ Clean |
NC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(=O)O)C(=O)O
|
| ZINC12954078 ZINC | 0.529 | 222.2 Da LogP 0.82 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)Nc1ccccc1)C(=O)O
|
| ZINC12954085 ZINC | 0.529 | 222.2 Da LogP 0.82 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)Nc1ccccc1)C(=O)O
|
| ZINC2106542 ZINC | 0.519 | 245.3 Da LogP 1.99 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCCCCCC(=O)O)C(=O)O
|
| ZINC2106543 ZINC | 0.519 | 245.3 Da LogP 1.99 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCCCCCCC(=O)O)C(=O)O
|
| ZINC2108713 ZINC | 0.519 | 217.3 Da LogP 1.21 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCCCCC(=O)O)C(=O)O
|
| ZINC2108714 ZINC | 0.519 | 217.3 Da LogP 1.21 TPSA 100.6 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCCCCC(=O)O)C(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.