KpKP13 Protein target profile
Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta
Accession: KP13_01024
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 29.091 Lower values reduce human off-target concern.
- Human E-value
- 8.61e-06
- Gut microbiome similarity
- 11.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 94.118 Higher values support similarity to known essential genes.
- DEG E-value
- 0.0 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 87.26 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MALCAPYDKTGIDQVQAERLSMSWIERIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMSARNRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYAMPVVAAAFEFSFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPVAVSEAPHEGVVVPPAPDQEPEA
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
8- GO:0003989 Catalysis of the reaction: ATP + acetyl-CoA + HCO3- = ADP + phosphate + malonyl-CoA.
- GO:0009317 A protein complex that catalyzes the first step in long-chain fatty acid biosynthesis. For example, in E. coli the complex is heterohexameric and composed of biotin carbonyl carrier protein, biotin carboxylase and the acetate CoA-transferase complex.
- GO:0006633 The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
- GO:0009329 A heterotetrameric enzyme complex made up of two alpha subunits and two beta subunits. Part of the acetyl-CoA carboxylase complex. Catalyzes the transfer of a carboxyl group to form malonyl-CoA.
- GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
- GO:0016743 Catalysis of the transfer of a carboxyl- or carbamoyl group from one compound (donor) to another (acceptor).
- GO:0008270 Binding to a zinc ion (Zn).
- GO:2001295 The chemical reactions and pathways resulting in the formation of malonyl-CoA, the S-malonyl derivative of coenzyme A.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 219 | 236 | PRINTS | PR01070 | Acetyl-CoA carboxylase carboxyl transferase beta subunit signature |
| 219 | 236 | InterPro | IPR000438 | Acetyl-CoA carboxylase carboxyl transferase, beta subunit |
| 248 | 259 | PRINTS | PR01070 | Acetyl-CoA carboxylase carboxyl transferase beta subunit signature |
| 248 | 259 | InterPro | IPR000438 | Acetyl-CoA carboxylase carboxyl transferase, beta subunit |
| 148 | 162 | PRINTS | PR01070 | Acetyl-CoA carboxylase carboxyl transferase beta subunit signature |
| 148 | 162 | InterPro | IPR000438 | Acetyl-CoA carboxylase carboxyl transferase, beta subunit |
| 270 | 279 | PRINTS | PR01070 | Acetyl-CoA carboxylase carboxyl transferase beta subunit signature |
| 270 | 279 | InterPro | IPR000438 | Acetyl-CoA carboxylase carboxyl transferase, beta subunit |
| 182 | 200 | PRINTS | PR01070 | Acetyl-CoA carboxylase carboxyl transferase beta subunit signature |
| 182 | 200 | InterPro | IPR000438 | Acetyl-CoA carboxylase carboxyl transferase, beta subunit |
| 44 | 301 | SUPERFAMILY | SSF52096 | ClpP/crotonase |
| 44 | 301 | InterPro | IPR029045 | ClpP/crotonase-like domain superfamily |
| 28 | 300 | PANTHER | PTHR42995 | ACETYL-COENZYME A CARBOXYLASE CARBOXYL TRANSFERASE SUBUNIT BETA, CHLOROPLASTIC |
| 44 | 313 | ProSiteProfiles | PS50980 | Acetyl-coenzyme A (CoA) carboxyltransferase N-terminal domain profile. |
| 44 | 313 | InterPro | IPR011762 | Acetyl-coenzyme A carboxyltransferase, N-terminal |
| 44 | 303 | FunFam | G3DSA:3.90.226.10:FF:000013 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta |
| 45 | 70 | Pfam | PF17848 | Acetyl-coA carboxylase zinc finger domain |
| 45 | 70 | InterPro | IPR041010 | Acetyl-coA carboxylase zinc finger domain |
| 112 | 259 | Pfam | PF01039 | Carboxyl transferase domain |
| 112 | 259 | InterPro | IPR034733 | Acetyl-CoA carboxylase |
| 22 | 302 | NCBIfam | TIGR00515 | acetyl-CoA carboxylase, carboxyltransferase subunit beta |
| 22 | 302 | InterPro | IPR000438 | Acetyl-CoA carboxylase carboxyl transferase, beta subunit |
| 22 | 300 | Hamap | MF_01395 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic [accD]. |
| 22 | 300 | InterPro | IPR000438 | Acetyl-CoA carboxylase carboxyl transferase, beta subunit |
| 44 | 302 | Gene3D | G3DSA:3.90.226.10 | - |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GT58
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_01024
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 1VU RCSB PDB | Q9X4K7 | 823.6 Da LogP -0.93 TPSA 363.6 | 3 viol. | ✓ Clean |
CCC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP(=O)(O…
|
|
| BTI RCSB PDB | Q168G2 | 228.3 Da LogP 0.91 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
C1[C@H]2[C@@H]([C@@H](S1)CCCCC=O)NC(=O)N2
|
|
| DXX RCSB PDB | Q8GBW6 | 118.1 Da LogP -0.21 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
CC(C(=O)O)C(=O)O
|
|
| HXC RCSB PDB | A0ACI9 | 865.7 Da LogP 0.25 TPSA 363.6 | 3 viol. | ✓ Clean |
CCCCCC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P@@…
|
|
| MCA RCSB PDB | Q8GBW6 | 867.6 Da LogP -1.61 TPSA 400.9 | 3 viol. | ✓ Clean |
C[C@H](C(=O)O)C(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)…
|
|
| YT5 RCSB PDB | Q2FXM6 | 453.5 Da LogP 1.98 TPSA 121.4 | ✓ Ro5 | ✓ Clean |
C/C=C/C=C/C(=O)N[C@@H](CC(=O)N[C@@H](C(C)C)C(=O…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC34603442 ZINC | 0.703 | 215.3 Da LogP 0.28 TPSA 67.1 | ✓ Ro5 | ✓ Clean |
NCCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12
|
| ZINC34182012 ZINC | 0.667 | 230.3 Da LogP 0.70 TPSA 61.4 | ✓ Ro5 | ✓ Clean |
O=C1N[C@@H]2[C@H](CCCCCO)SC[C@@H]2N1
|
| ZINC1532548 ZINC | 0.634 | 244.3 Da LogP 0.80 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCC[C@H]1SC[C@@H]2NC(=O)N[C@@H]21
|
| ZINC2169825 ZINC | 0.634 | 244.3 Da LogP 0.80 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCC[C@H]1SC[C@H]2NC(=O)N[C@H]21
|
| ZINC2169827 ZINC | 0.634 | 244.3 Da LogP 0.80 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCC[C@H]1SC[C@@H]2NC(=O)N[C@H]21
|
| ZINC3869709 ZINC | 0.634 | 243.3 Da LogP 0.20 TPSA 84.2 | ✓ Ro5 | ✓ Clean |
NC(=O)CCCC[C@@H]1SC[C@H]2NC(=O)N[C@@H]21
|
| ZINC3869710 ZINC | 0.634 | 243.3 Da LogP 0.20 TPSA 84.2 | ✓ Ro5 | ✓ Clean |
NC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12
|
| ZINC3869711 ZINC | 0.634 | 243.3 Da LogP 0.20 TPSA 84.2 | ✓ Ro5 | ✓ Clean |
NC(=O)CCCC[C@@H]1SC[C@H]2NC(=O)N[C@H]21
|
| ZINC3869712 ZINC | 0.634 | 243.3 Da LogP 0.20 TPSA 84.2 | ✓ Ro5 | ✓ Clean |
NC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@@H]12
|
| ZINC22052067 ZINC | 0.609 | 301.4 Da LogP -0.09 TPSA 107.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12
|
| ZINC59286406 ZINC | 0.609 | 300.4 Da LogP -0.69 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
NC(=O)CNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12
|
| ZINC222024244 ZINC | 0.600 | 283.4 Da LogP 0.99 TPSA 70.2 | ✓ Ro5 | ✓ Clean |
O=C(CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@@H]12)NC1CC1
|
| ZINC48391181 ZINC | 0.600 | 283.4 Da LogP 0.99 TPSA 70.2 | ✓ Ro5 | ✓ Clean |
O=C(CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12)NC1CC1
|
| ZINC53464107 ZINC | 0.600 | 283.4 Da LogP 0.99 TPSA 70.2 | ✓ Ro5 | ✓ Clean |
O=C(CCCC[C@@H]1SC[C@H]2NC(=O)N[C@@H]21)NC1CC1
|
| ZINC53464111 ZINC | 0.600 | 283.4 Da LogP 0.99 TPSA 70.2 | ✓ Ro5 | ✓ Clean |
O=C(CCCC[C@@H]1SC[C@H]2NC(=O)N[C@H]21)NC1CC1
|
| ZINC2121285 ZINC | 0.578 | 258.3 Da LogP 0.89 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
COC(=O)CCCC[C@@H]1SC[C@H]2NC(=O)N[C@H]21
|
| ZINC4038545 ZINC | 0.578 | 258.3 Da LogP 0.89 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
COC(=O)CCCC[C@H]1SC[C@H]2NC(=O)N[C@H]21
|
| ZINC5005298 ZINC | 0.578 | 258.3 Da LogP 0.89 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
COC(=O)CCCC[C@@H]1SC[C@H]2NC(=O)N[C@@H]21
|
| ZINC5224322 ZINC | 0.578 | 258.3 Da LogP 0.89 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
COC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12
|
| ZINC90514224 ZINC | 0.578 | 258.3 Da LogP 0.89 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
COC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@@H]12
|
| ZINC27065097 ZINC | 0.574 | 311.5 Da LogP 1.77 TPSA 70.2 | ✓ Ro5 | ✓ Clean |
O=C(CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12)NC1CCCC1
|
| ZINC5157321 ZINC | 0.574 | 287.4 Da LogP -0.18 TPSA 90.5 | ✓ Ro5 | ✓ Clean |
O=C(CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12)NCCO
|
| ZINC206908803 ZINC | 0.571 | 315.4 Da LogP 0.00 TPSA 96.5 | ✓ Ro5 | ✓ Clean |
COC(=O)CNC(=O)CCCC[C@@H]1SC[C@H]2NC(=O)N[C@@H]21
|
| ZINC334161970 ZINC | 0.571 | 315.4 Da LogP 0.00 TPSA 96.5 | ✓ Ro5 | ✓ Clean |
COC(=O)CNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@@H]…
|
| ZINC62001297 ZINC | 0.571 | 315.4 Da LogP 0.00 TPSA 96.5 | ✓ Ro5 | ✓ Clean |
COC(=O)CNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12
|
| ZINC75611263 ZINC | 0.571 | 315.4 Da LogP 0.00 TPSA 96.5 | ✓ Ro5 | ✓ Clean |
COC(=O)CNC(=O)CCCC[C@@H]1SC[C@H]2NC(=O)N[C@H]21
|
| ZINC104112886 ZINC | 0.568 | 242.3 Da LogP 0.57 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C\CC[C@@H]1SC[C@H]2NC(=O)N[C@@H]21
|
| ZINC13543600 ZINC | 0.568 | 242.3 Da LogP 0.57 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C\CC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12
|
| ZINC4216800 ZINC | 0.568 | 242.3 Da LogP 0.57 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C/CC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12
|
| ZINC5082085 ZINC | 0.568 | 242.3 Da LogP 0.57 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C/CC[C@@H]1SC[C@H]2NC(=O)N[C@@H]21
|
| ZINC5082088 ZINC | 0.568 | 242.3 Da LogP 0.57 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C/CC[C@@H]1SC[C@H]2NC(=O)N[C@H]21
|
| ZINC5082090 ZINC | 0.568 | 242.3 Da LogP 0.57 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
O=C(O)/C=C/CC[C@@H]1SC[C@@H]2NC(=O)N[C@@H]12
|
| ZINC77273222 ZINC | 0.568 | 428.6 Da LogP 1.36 TPSA 119.6 | ✓ Ro5 | ✓ Clean |
O=C1N[C@@H]2[C@H](CCCC(CCC[C@@H]3SC[C@@H]4NC(=O…
|
| ZINC107559942 ZINC | 0.563 | 283.4 Da LogP 1.01 TPSA 70.2 | ✓ Ro5 | ✓ Clean |
C=CCNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12
|
| ZINC12624504 ZINC | 0.563 | 339.5 Da LogP 2.55 TPSA 70.2 | ✓ Ro5 | ✓ Clean |
O=C(CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12)NC1CCCCC…
|
| ZINC13509480 ZINC | 0.563 | 315.4 Da LogP 0.30 TPSA 107.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CCNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12
|
| ZINC141396702 ZINC | 0.563 | 303.5 Da LogP 0.76 TPSA 70.2 | ✓ Ro5 | ✓ Clean |
O=C(CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12)NCCS
|
| ZINC149421996 ZINC | 0.563 | 286.4 Da LogP -0.21 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
NCCNC(=O)CCCC[C@H]1SC[C@H]2NC(=O)N[C@H]21
|
| ZINC22048411 ZINC | 0.563 | 286.4 Da LogP -0.21 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
NCCNC(=O)CCCC[C@@H]1SC[C@H]2NC(=O)N[C@@H]21
|
| ZINC222218978 ZINC | 0.563 | 284.4 Da LogP 1.44 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
C=CCOC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@@H]12
|
| ZINC222438745 ZINC | 0.563 | 339.5 Da LogP 2.55 TPSA 70.2 | ✓ Ro5 | ✓ Clean |
O=C(CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@@H]12)NC1CCCC…
|
| ZINC34440530 ZINC | 0.563 | 301.4 Da LogP 0.21 TPSA 90.5 | ✓ Ro5 | ✓ Clean |
O=C(CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12)NCCCO
|
| ZINC39935771 ZINC | 0.563 | 286.4 Da LogP -0.21 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
NCCNC(=O)CCCC[C@@H]1SC[C@H]2NC(=O)N[C@H]21
|
| ZINC39935772 ZINC | 0.563 | 286.4 Da LogP -0.21 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
NCCNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@@H]12
|
| ZINC5192432 ZINC | 0.563 | 286.4 Da LogP -0.21 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
NCCNC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12
|
| ZINC80301665 ZINC | 0.563 | 284.4 Da LogP 1.44 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
C=CCOC(=O)CCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12
|
| ZINC95966269 ZINC | 0.563 | 284.4 Da LogP 1.44 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
C=CCOC(=O)CCCC[C@@H]1SC[C@H]2NC(=O)N[C@@H]21
|
| ZINC95966271 ZINC | 0.563 | 284.4 Da LogP 1.44 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
C=CCOC(=O)CCCC[C@@H]1SC[C@H]2NC(=O)N[C@H]21
|
| ZINC9691512 ZINC | 0.563 | 339.5 Da LogP 2.55 TPSA 70.2 | ✓ Ro5 | ✓ Clean |
O=C(CCCC[C@@H]1SC[C@H]2NC(=O)N[C@@H]21)NC1CCCCC…
|
| ZINC9691514 ZINC | 0.563 | 339.5 Da LogP 2.55 TPSA 70.2 | ✓ Ro5 | ✓ Clean |
O=C(CCCC[C@@H]1SC[C@H]2NC(=O)N[C@H]21)NC1CCCCCC1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.