Protein target profile

KP13_01015

Histidine transport system permease protein hisQ

Genome: KpKP13 Gene: hisQ AHE43457.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3H128
Export view
Length 235
Pocket druggability 0.89
Functional annotation 0 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Strong predicted binding pocket FPocket selected-pocket score 0.89. This is a computational pocket signal, not binding validation. Structure available AlphaFold DB model + ColabFold model

Risks to review

Microbiome similarity 108 of 4744 screened genomes (2.3%) have a significant similarity hit. This target also has a predicted binding pocket (FPocket 0.89) — check the ligand evidence before deprioritizing on off-target risk alone. Weak second pocket-predictor signal P2Rank predicted binding-site probability 0.48.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
91.16 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.89
Structure A0A0H3H128
Pocket Pocket 1
P2Rank 0.482
Structure A0A0H3H128
Pocket Pocket 1
ColabFold model
FPocket 0.83 · Pocket 7
P2Rank 0.442 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 108 / 4744 genomes with a hit
Prevalence 2.3%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3H128

Sequence

Primary amino-acid sequence viewer.

MTDRVGSMLYGFSQVILQGALVTLELALSSVVLAVLIGLAGAGAKLSSNRPLALVFEGYTTLIRGVPDLVLMLLIFYGLQIALNSVTDALGMAQFDIDPMIAGIITLGFIYGAYFTETFRGAYLAVPKGHIEAATAFGFSGGQTFRRILFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKATQLAGKSTWQPFYFAIVCGLIYLVFTTVSNGVLLLLERRYTVGVKRADL

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0043190 A complex for the transport of metabolites into and out of the cell, typically comprised of four domains; two membrane-associated domains and two ATP-binding domains at the intracellular face of the membrane, that form a central pore through the plasma membrane. Each of the four core domains may be encoded as a separate polypeptide or the domains can be fused in any one of a number of ways into multidomain polypeptides. In Bacteria and Archaebacteria, ABC transporters also include substrate binding proteins to bind substrate external to the cytoplasm and deliver it to the transporter.
  • GO:0071705 The directed movement of nitrogen-containing compounds into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0006865 The directed movement of amino acids, organic acids containing one or more amino substituents, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

30 records
Show feature table
Start End DB Term Name
179 197 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
14 121 NCBIfam TIGR01726 ABC transporter permease subunit, His/Glu/Gln/Arg/opine family, N-terminal region
14 121 InterPro IPR010065 Amino acid ABC transporter, permease protein, 3-TM domain
116 155 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
14 212 SUPERFAMILY SSF161098 MetI-like
14 212 InterPro IPR035906 MetI-like superfamily
198 220 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
156 178 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
20 214 CDD cd06261 TM_PBP2
20 214 InterPro IPR000515 ABC transporter type 1, transmembrane domain MetI-like
1 14 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
8 229 FunFam G3DSA:1.10.3720.10:FF:000020 Histidine ABC transporter permease HisQ
52 77 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
97 115 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
62 84 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
41 51 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
198 222 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
7 229 Gene3D G3DSA:1.10.3720.10 -
7 229 InterPro IPR035906 MetI-like superfamily
223 235 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
156 178 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
15 40 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
99 116 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
20 219 ProSiteProfiles PS50928 ABC transporter integral membrane type-1 domain profile.
20 219 InterPro IPR000515 ABC transporter type 1, transmembrane domain MetI-like
20 42 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
78 96 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
8 234 PANTHER PTHR30133 CATIONIC AMINO ACID TRANSPORTER, MEMBRANE COMPONENT
36 227 Pfam PF00528 Binding-protein-dependent transport system inner membrane component
36 227 InterPro IPR000515 ABC transporter type 1, transmembrane domain MetI-like

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.89
Likely same site as P2Rank 1 0.5 Å 11 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 2 FPocket #5
0.239
Likely same site as P2Rank 2 3.7 Å 8 shared residues 89% of smaller site
Unusual size
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.482
Likely same site as FPocket 1 0.5 Å 11 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.377
Likely same site as FPocket 5 3.7 Å 8 shared residues 89% of smaller site
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.012
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3H128
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_01015
ColabFold — — full sequence — Loaded