Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 21.866 Lower values reduce human off-target concern.
- Human E-value
- 7.77e-12
- Gut microbiome similarity
- 2.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 49.672 Higher values support similarity to known essential genes.
- DEG E-value
- 4.63e-141 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 95.42 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MTITPQQLIALLPLLIVGLTVVVVMLSIAWRRNHFLNATLSVLGLNAALVSLWFVGQNGAMDVTPLIRVDGYAMLYTGLVLLASLATCTFAYPWLEGYKDNKEEFYLLVLIAALGGILLAGANHLAALFLGIELISLPLFGLVGYAFRQKRSLEASIKYTILSAAASSFLLFGMALVYANSGNLSFLALGKSLADNMLHEPLLLAGLGLMIVGLGFKLSLVPFHLWTPDVYQGAPAPVSTFLATASKIAIFGVVMRLFLYMPVGNSEAVRVVLGLIAFASIIFGNLMALSQTNIKRLLGYSSISHLGYLLVALIALQSGEMSMEAVGVYLAGYLFSSLGAFGVVSLMSSPYRGPDADSLFSYRGLFWHRPILSAVMTVMMLSLAGIPMTLGFIGKFYVLAVGVHAHLWWLVAAVVVGSAIGLYYYLRVAVSLYLSAPEQLNRDAPSNWQYSAGGIVVLISALLVLVLGIWPQPLISIVQLATPLM
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Enzyme Commission (EC)
1Gene Ontology (GO)
6- GO:0042773 The transfer of electrons through a series of electron donors and acceptors, generating energy that is ultimately used for synthesis of ATP.
- GO:0008137 Catalysis of the reaction: NADH + ubiquinone + 5 H+(in) = NAD+ + ubiquinol + 4 H+(out).
- GO:0012505 A collection of membranous structures involved in transport within the cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0050136 Catalysis of the reaction: NADH + H+ + a quinone = NAD+ + a quinol.
- GO:0048038 Binding to a quinone, any member of a class of diketones derivable from aromatic compounds by conversion of two CH groups into CO groups with any necessary rearrangement of double bonds.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 125 | 147 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 471 | 485 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 297 | 316 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 29 | 34 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 406 | 426 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 352 | 370 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 447 | 470 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 56 | 74 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 427 | 446 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 1 | 5 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 238 | 259 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 35 | 55 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 236 | 258 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 21 | 479 | PANTHER | PTHR22773 | NADH DEHYDROGENASE |
| 268 | 290 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 159 | 181 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 201 | 226 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 260 | 270 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 271 | 290 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 450 | 472 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 9 | 475 | NCBIfam | TIGR01770 | NADH-quinone oxidoreductase subunit NuoN |
| 9 | 475 | InterPro | IPR010096 | NAD(P)H-quinone oxidoreductase, subunit N/subunit 2 |
| 371 | 393 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 106 | 121 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 6 | 475 | Hamap | MF_00445 | NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic [ndhB]. |
| 6 | 475 | InterPro | IPR010096 | NAD(P)H-quinone oxidoreductase, subunit N/subunit 2 |
| 148 | 158 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 291 | 296 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 328 | 351 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 6 | 28 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 201 | 223 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 408 | 430 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 159 | 181 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 371 | 394 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 122 | 420 | Pfam | PF00361 | Proton-conducting membrane transporter |
| 122 | 420 | InterPro | IPR001750 | NADH:quinone oxidoreductase/Mrp antiporter, membrane subunit |
| 297 | 319 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 329 | 351 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 6 | 28 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 317 | 327 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 35 | 57 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 227 | 237 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 123 | 127 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 182 | 200 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 94 | 104 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 128 | 147 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 75 | 93 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 395 | 405 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 72 | 94 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 105 | 122 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GWA2
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_00981
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 3PE RCSB PDB | O78748 | 748.1 Da LogP 12.06 TPSA 134.4 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCN)OC…
|
|
| 970 RCSB PDB | O78748 | 394.4 Da LogP 3.70 TPSA 63.2 | ✓ Ro5 | ✓ Clean |
CC(=C)[C@H]1Cc2c(ccc3c2O[C@@H]4COc5cc(c(cc5[C@@…
|
|
| AYA RCSB PDB | O78748 | 131.1 Da LogP -0.40 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
C[C@@H](C(=O)O)NC(=O)C
|
|
| BCR RCSB PDB | Q8DKX9 | 536.9 Da LogP 12.61 TPSA 0.0 | 2 viol. | ✓ Clean |
CC1=C(C(CCC1)(C)C)\C=C\C(=C\C=C\C(=C\C=C\C=C(/C…
|
|
| CDL RCSB PDB | O78748 | 1464.1 Da LogP 23.31 TPSA 242.6 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)([O-])OCC(…
|
|
| DCQ RCSB PDB | O78748 | 322.4 Da LogP 4.49 TPSA 52.6 | ✓ Ro5 | Alert |
CCCCCCCCCCC1=C(C(=O)C(=C(C1=O)OC)OC)C
|
|
| DGD RCSB PDB | Q8DKX9 | 949.3 Da LogP 7.61 TPSA 231.1 | 4 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](CO[C@H]1[C@@H]([C…
|
|
| FES RCSB PDB | Q8DKX9 | 175.8 Da LogP 1.29 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
S1[Fe]S[Fe]1
|
|
| FME RCSB PDB | O78748 | 177.2 Da LogP -0.06 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
CSCC[C@@H](C(=O)O)NC=O
|
|
| LHG RCSB PDB | Q8DKX9 | 723.0 Da LogP 9.89 TPSA 148.8 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@…
|
|
| LMG RCSB PDB | Q8DKX9 | 787.2 Da LogP 9.78 TPSA 152.0 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](CO[C@H]1[C@@H]([C…
|
|
| MYR RCSB PDB | O78748 | 228.4 Da LogP 4.77 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)O
|
|
| PC1 RCSB PDB | P03892 | 790.2 Da LogP 12.17 TPSA 111.2 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](CO[P@@](=O)([O-])…
|
|
| PGT RCSB PDB | Q8DMR6 | 751.0 Da LogP 10.67 TPSA 148.8 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)O[C@@H](COC(=O)CCCCCCCCCC…
|
|
| PL9 RCSB PDB | Q8DKX9 | 749.2 Da LogP 16.57 TPSA 34.1 | 2 viol. | Alert |
CC1=C(C(=O)C(=CC1=O)CC=C(C)CCC=C(C)CCC=C(C)CCC=…
|
|
| PNS RCSB PDB | O78748 | 358.4 Da LogP -0.96 TPSA 145.2 | 1 viol. | ✓ Clean |
CC(C)(COP(=O)(O)O)[C@H](C(=O)NCCC(=O)NCCS)O
|
|
| PQN RCSB PDB | Q8DKX9 | 450.7 Da LogP 9.16 TPSA 34.1 | 1 viol. | Alert |
CC1=C(C(=O)c2ccccc2C1=O)C\C=C(/C)\CCC[C@H](C)CC…
|
|
| SQD RCSB PDB | Q8DKX9 | 795.1 Da LogP 8.12 TPSA 186.1 | 3 viol. | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](COC1[C@@H]([C@H]([C…
|
|
| UMQ RCSB PDB | Q56229 | 496.6 Da LogP -0.84 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCCO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1)…
|
|
| UQ2 RCSB PDB | P03892 | 318.4 Da LogP 4.04 TPSA 52.6 | ✓ Ro5 | Alert |
CC1=C(C(=O)C(=C(C1=O)OC)OC)C\C=C(/C)\CCC=C(C)C
|
|
| ZMP RCSB PDB | O78748 | 568.7 Da LogP 4.07 TPSA 162.3 | 1 viol. | ✓ Clean |
CCCCCCCCCCCCCC(=O)SCCNC(=O)CCNC(=O)[C@H](C(C)(C…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC102191119 ZINC | 1.000 | 498.6 Da LogP 3.65 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@@H](O)CO…
|
| ZINC13522091 ZINC | 1.000 | 394.4 Da LogP 3.70 TPSA 63.2 | ✓ Ro5 | ✓ Clean |
C=C(C)[C@@H]1Cc2c(ccc3c2O[C@@H]2COc4cc(OC)c(OC)…
|
| ZINC1529498 ZINC | 1.000 | 200.3 Da LogP 3.99 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)O
|
| ZINC1530417 ZINC | 1.000 | 228.4 Da LogP 4.77 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)O
|
| ZINC1530836 ZINC | 1.000 | 394.4 Da LogP 3.70 TPSA 63.2 | ✓ Ro5 | ✓ Clean |
C=C(C)[C@@H]1Cc2c(ccc3c2O[C@H]2COc4cc(OC)c(OC)c…
|
| ZINC1628119 ZINC | 1.000 | 214.3 Da LogP 4.38 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCC(=O)O
|
| ZINC2053493149 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@H]1O[C@H](CO)[C@H](O[C@@H]2O[C@H]…
|
| ZINC2548962 ZINC | 1.000 | 394.4 Da LogP 3.70 TPSA 63.2 | ✓ Ro5 | ✓ Clean |
C=C(C)[C@@H]1Cc2c(ccc3c2O[C@H]2COc4cc(OC)c(OC)c…
|
| ZINC3860715 ZINC | 1.000 | 394.4 Da LogP 3.70 TPSA 63.2 | ✓ Ro5 | ✓ Clean |
C=C(C)[C@H]1Cc2c(ccc3c2O[C@@H]2COc4cc(OC)c(OC)c…
|
| ZINC3874884 ZINC | 1.000 | 394.4 Da LogP 3.70 TPSA 63.2 | ✓ Ro5 | ✓ Clean |
C=C(C)[C@@H]1Cc2c(ccc3c2O[C@@H]2COc4cc(OC)c(OC)…
|
| ZINC3874885 ZINC | 1.000 | 394.4 Da LogP 3.70 TPSA 63.2 | ✓ Ro5 | ✓ Clean |
C=C(C)[C@H]1Cc2c(ccc3c2O[C@H]2COc4cc(OC)c(OC)cc…
|
| ZINC58649551 ZINC | 1.000 | 498.6 Da LogP 3.65 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@H](O)CO)…
|
| ZINC70669943 ZINC | 1.000 | 482.6 Da LogP -1.23 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCCCCCO[C@@H]1O[C@@H](CO)[C@@H](O[C@H]2O[C@…
|
| ZINC86002923 ZINC | 1.000 | 426.5 Da LogP -2.79 TPSA 178.5 | 2 viol. | ✓ Clean |
CCCCCCO[C@@H]1O[C@H](CO)[C@H](O[C@H]2O[C@H](CO)…
|
| ZINC8660420 ZINC | 1.000 | 394.4 Da LogP 3.70 TPSA 63.2 | ✓ Ro5 | ✓ Clean |
C=C(C)[C@H]1Cc2c(ccc3c2O[C@@H]2COc4cc(OC)c(OC)c…
|
| ZINC226792912 ZINC | 0.860 | 396.4 Da LogP 2.72 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
COc1cc2c(cc1OC)[C@@H]1C(=O)c3ccc4c(c3O[C@@H]1CO…
|
| ZINC226792928 ZINC | 0.860 | 396.4 Da LogP 2.72 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
COc1cc2c(cc1OC)[C@@H]1C(=O)c3ccc4c(c3O[C@H]1CO2…
|
| ZINC230121190 ZINC | 0.860 | 396.4 Da LogP 2.72 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
COc1cc2c(cc1OC)[C@@H]1C(=O)c3ccc4c(c3O[C@@H]1CO…
|
| ZINC230121201 ZINC | 0.860 | 396.4 Da LogP 2.72 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
COc1cc2c(cc1OC)[C@@H]1C(=O)c3ccc4c(c3O[C@H]1CO2…
|
| ZINC138457918 ZINC | 0.850 | 228.3 Da LogP 3.56 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)CCCCC(=O)O
|
| ZINC138458029 ZINC | 0.850 | 228.3 Da LogP 3.56 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCCC(=O)O
|
| ZINC144395054 ZINC | 0.850 | 242.4 Da LogP 3.95 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCCCCC(=O)O
|
| ZINC14619628 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCCCCCCC(=O)O
|
| ZINC196749828 ZINC | 0.850 | 214.3 Da LogP 3.17 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCC(=O)O
|
| ZINC2113934076 ZINC | 0.850 | 256.4 Da LogP 4.34 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCCCCC(=O)O
|
| ZINC2113934082 ZINC | 0.850 | 256.4 Da LogP 4.34 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)CCCCCCC(=O)O
|
| ZINC2113934083 ZINC | 0.850 | 256.4 Da LogP 4.34 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC(=O)CCCCC(=O)O
|
| ZINC2243670 ZINC | 0.850 | 228.3 Da LogP 3.56 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCCCC(=O)O
|
| ZINC2569203 ZINC | 0.850 | 214.3 Da LogP 3.17 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)CCCCCC(=O)O
|
| ZINC4798470 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCCCCCC(=O)O
|
| ZINC5973005 ZINC | 0.850 | 242.4 Da LogP 3.95 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCCCCC(=O)O
|
| ZINC71418182 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC(=O)CCCCC(=O)O
|
| ZINC79244776 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)CCCCCCCC(=O)O
|
| ZINC86037082 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC(=O)CCCCCC(=O)O
|
| ZINC86037089 ZINC | 0.850 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC(=O)CCCCCCC(=O)O
|
| ZINC86039283 ZINC | 0.850 | 242.4 Da LogP 3.95 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC(=O)CCCCC(=O)O
|
| ZINC13813085 ZINC | 0.820 | 410.4 Da LogP 2.68 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C=C(CO)[C@@H]1Cc2c(ccc3c2O[C@H]2COc4cc(OC)c(OC)…
|
| ZINC13813088 ZINC | 0.820 | 410.4 Da LogP 2.68 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C=C(CO)[C@@H]1Cc2c(ccc3c2O[C@@H]2COc4cc(OC)c(OC…
|
| ZINC2115043 ZINC | 0.820 | 410.4 Da LogP 2.68 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C=C(CO)[C@@H]1Cc2c(ccc3c2O[C@@H]2COc4cc(OC)c(OC…
|
| ZINC36387001 ZINC | 0.820 | 410.4 Da LogP 2.68 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C=C(CO)[C@@H]1Cc2c(ccc3c2O[C@H]2COc4cc(OC)c(OC)…
|
| ZINC3947515 ZINC | 0.820 | 410.4 Da LogP 2.68 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
C=C(CO)[C@H]1Cc2c(ccc3c2O[C@@H]2COc4cc(OC)c(OC)…
|
| ZINC2242696 ZINC | 0.810 | 273.3 Da LogP -1.39 TPSA 124.6 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C…
|
| ZINC2566274 ZINC | 0.810 | 344.4 Da LogP -1.89 TPSA 153.7 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C…
|
| ZINC2572098 ZINC | 0.810 | 202.2 Da LogP -0.90 TPSA 95.5 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)O
|
| ZINC4582907 ZINC | 0.810 | 200.3 Da LogP 2.78 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCCC(=O)O
|
| ZINC4727003 ZINC | 0.810 | 312.4 Da LogP 4.69 TPSA 71.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)CCC(=O)CCCCCCCC(=O)O
|
| ZINC5706638 ZINC | 0.810 | 344.4 Da LogP -1.89 TPSA 153.7 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(…
|
| ZINC5706639 ZINC | 0.810 | 344.4 Da LogP -1.89 TPSA 153.7 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@@H](C)C(=O)N[C@H](C)C(=O)N[C@@H](C)C(…
|
| ZINC5706640 ZINC | 0.810 | 344.4 Da LogP -1.89 TPSA 153.7 | ✓ Ro5 | ✓ Clean |
CC(=O)N[C@H](C)C(=O)N[C@H](C)C(=O)N[C@@H](C)C(=…
|
| ZINC86037074 ZINC | 0.810 | 270.4 Da LogP 4.73 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)CCCC(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.