KpKP13 Protein target profile

Glycerol-3-phosphate transporter

Accession: KP13_00961

Gene: AHE43509.1 glpT 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GR29
Length 448
Pocket druggability (P2Rank · AlphaFold DB model) 0.945
Direct ligand evidence 0 58 total records
Functional annotation 0 EC 8 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
29.545 Lower values reduce human off-target concern.
Human E-value
1.84e-33
Gut microbiome similarity
5.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
43.653 Higher values support similarity to known essential genes.
DEG E-value
6.25e-124 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
86.64 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.945
Structure A0A0H3GR29
Pocket Pocket 1
Druggability (FPocket) 0.564
Structure A0A0H3GR29
Pocket Pocket 27
ColabFold model
P2Rank 0.942 · Pocket 1
FPocket 0.774 · Pocket 2
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 270 / 4744 genomes with a hit
Prevalence 5.7%

Sequence

Primary amino-acid sequence viewer.

MLSIFKPAAHKARLPAAEIDPLYRRLRWQIFIGIFFGYAAYYLVRKNFALAMPYLIEQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRIFLPAGLILAALVMLVMGFVPWATSSIMIMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFGAILLAIFAFAMMRDTPQSCGLPPIEEYKNDYPDDYSEKHEEELTAKQIFMQYILPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFKGNRGATGVFFMTLVTIATVVYWLNPPGNPGVDMACMIIIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFGWDGGFMVMIGGSVLAVILLVIVMLGERRHHQQLKQA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

8 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

8
  • GO:0015794 The process in which glycerol-3-phosphate is transported across a membrane. Glycerol-3-phosphate is a phosphoric monoester of glycerol.
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0015169 Enables the transfer of glycerol-3-phosphate from one side of a membrane to the other. Glycerol-3-phosphate is a phosphoric monoester of glycerol.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0061513 Enables the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: glucose 6-phosphate(out) + phosphate(in) = glucose 6-phosphate(in) + phosphate(out).
  • GO:0035435 The process in which a phosphate is transported across a membrane.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

58 records
Show feature table
Start End DB Term Name
319 341 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
153 169 ProSitePatterns PS00942 glpT family of transporters signature.
153 169 InterPro IPR021159 Glycerate/sugar phosphate transporter, conserved site
351 373 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
184 188 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
343 353 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
159 183 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
26 44 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
18 226 FunFam G3DSA:1.20.1250.20:FF:000007 Glycerol-3-phosphate transporter
139 158 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
385 405 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
417 437 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
45 63 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
354 373 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
114 118 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
386 408 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 440 NCBIfam TIGR00712 glycerol-3-phosphate transporter
1 440 InterPro IPR005267 Glycerol-3-phosphate transporter
28 45 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
209 253 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
374 384 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
27 435 CDD cd17345 MFS_GlpT
438 448 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
19 226 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
19 226 InterPro IPR036259 MFS transporter superfamily
94 113 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
83 93 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
64 82 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
406 416 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 25 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
35 417 NCBIfam TIGR00881 phosphoglycerate transporter protein PgtP
13 441 SUPERFAMILY SSF103473 MFS general substrate transporter
13 441 InterPro IPR036259 MFS transporter superfamily
254 273 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
119 138 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
292 311 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
5 448 PIRSF PIRSF002808 Hexose_phosphate_transp
5 448 InterPro IPR000849 Sugar phosphate transporter
312 322 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
187 206 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 444 PANTHER PTHR43826 GLUCOSE-6-PHOSPHATE EXCHANGER SLC37A4
240 448 FunFam G3DSA:1.20.1250.20:FF:000016 Glycerol-3-phosphate transporter
65 87 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
293 312 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
189 208 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
26 440 ProSiteProfiles PS50850 Major facilitator superfamily (MFS) profile.
26 440 InterPro IPR020846 Major facilitator superfamily domain
94 116 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
120 142 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
34 400 Pfam PF07690 Major Facilitator Superfamily
34 400 InterPro IPR011701 Major facilitator superfamily
155 177 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
240 448 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
240 448 InterPro IPR036259 MFS transporter superfamily
418 437 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
273 291 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
254 272 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
323 342 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.945
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.079
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.058
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.028
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.02
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #27
0.564 Unusual size
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GR29
AlphaFold DB full sequence Viewing
ColabFold KP13_00961
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 8 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 7 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
J0M PDB via homolog 196.2 Da · LogP -3.49 · TPSA 138.5 Open detail RCSB PDB
CHEMBL236247 ChEMBL via homolog · pchembl 8.70 (~2.0 nM) Detail ChEMBL
CHEMBL238371 ChEMBL via homolog · pchembl 8.30 (~5.0 nM) Detail ChEMBL
CHEMBL3218305 ChEMBL via homolog · pchembl 7.10 (~79.4 nM) Detail ChEMBL
CHEMBL3218306 ChEMBL via homolog · pchembl 6.89 (~128.8 nM) Detail ChEMBL

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
J0M RCSB PDB J7QAK3 196.2 Da LogP -3.49 TPSA 138.5 1 viol. ✓ Clean C([C@H]([C@@H]([C@@H]([C@H](C(=O)O)O)O)O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.