Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 32.584 Lower values reduce human off-target concern.
- Human E-value
- 4.6e-07
- Gut microbiome similarity
- 2.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 93.63 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKMKLTALMSGMILSSSALCFSATAADKMVIAHRGASGYLPEHTLPAKAMAYAQGAEYLEQDLVMTKDDRLVVLHDHYLDRVTDVAQRFPQRARQDGRFYAIDFTLAEIKSLKFTEGFEPKNGKNVQTYPGRFPMGKSDFRIHTFEEEIEFVQGLNHSTGKNIGIYPEIKAPWFHHQEGKDIAASTLKVLKEYGYTSKQDKVYLQCFDANELKRIKNELEPKMGMDLNLVQLIAYTDWNETQQKQADGKWVNYSYDWMFKPGAMAQIAQYADGIGPDYHMLVAEGSKPGAVKLTAMVKEAHASHLQVHPYTVRADQLPEYATNVNQLYDVLYNQAGVDGLFTDFPDKAVQFLDAKH
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Periplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
5- GO:0008081 Catalysis of the hydrolysis of a phosphodiester to give a phosphomonoester and a free hydroxyl group.
- GO:0006629 The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
- GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
- GO:0008889 Catalysis of the reaction: a glycerophosphodiester + H2O = an alcohol + sn-glycerol 3-phosphate.
- GO:0006071 The chemical reactions and pathways involving glycerol, 1,2,3-propanetriol, a sweet, hygroscopic, viscous liquid, widely distributed in nature as a constituent of many lipids.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 26 | 353 | FunFam | G3DSA:3.20.20.190:FF:000009 | Glycerophosphodiester phosphodiesterase, periplasmic |
| 33 | 347 | Pfam | PF03009 | Glycerophosphoryl diester phosphodiesterase family |
| 33 | 347 | InterPro | IPR030395 | Glycerophosphodiester phosphodiesterase domain |
| 1 | 25 | SignalP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM |
| 15 | 353 | PANTHER | PTHR43620 | GLYCEROPHOSPHORYL DIESTER PHOSPHODIESTERASE |
| 29 | 352 | SUPERFAMILY | SSF51695 | PLC-like phosphodiesterases |
| 29 | 352 | InterPro | IPR017946 | PLC-like phosphodiesterase, TIM beta/alpha-barrel domain superfamily |
| 23 | 356 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 28 | 346 | CDD | cd08600 | GDPD_EcGlpQ_like |
| 15 | 22 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 28 | 352 | ProSiteProfiles | PS51704 | GP-PDE domain profile. |
| 28 | 352 | InterPro | IPR030395 | Glycerophosphodiester phosphodiesterase domain |
| 27 | 353 | Gene3D | G3DSA:3.20.20.190 | Phosphatidylinositol (PI) phosphodiesterase |
| 27 | 353 | InterPro | IPR017946 | PLC-like phosphodiesterase, TIM beta/alpha-barrel domain superfamily |
| 1 | 25 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 5 | 14 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 1 | 26 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 1 | 22 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 1 | 4 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3H0Y9
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_00960
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1529618 ZINC | 0.739 | 246.2 Da LogP -2.17 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(OC[C@@H](O)CO)OC[C@H](O)CO
|
| ZINC1529620 ZINC | 0.739 | 246.2 Da LogP -2.17 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(OC[C@@H](O)CO)OC[C@@H](O)CO
|
| ZINC5975509 ZINC | 0.640 | 202.1 Da LogP -2.19 TPSA 127.5 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@H](O)[C@H](O)CO
|
| ZINC2516111 ZINC | 0.593 | 262.2 Da LogP -3.47 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)CO
|
| ZINC2522704 ZINC | 0.593 | 262.2 Da LogP -3.47 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)CO
|
| ZINC3869812 ZINC | 0.593 | 262.2 Da LogP -3.47 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO
|
| ZINC4095590 ZINC | 0.567 | 215.1 Da LogP -1.57 TPSA 122.2 | ✓ Ro5 | ✓ Clean |
NCCO[P@@](=O)(O)OC[C@H](O)CO
|
| ZINC4095591 ZINC | 0.567 | 215.1 Da LogP -1.57 TPSA 122.2 | ✓ Ro5 | ✓ Clean |
NCCO[P@@](=O)(O)OC[C@@H](O)CO
|
| ZINC1680142 ZINC | 0.533 | 212.1 Da LogP -0.34 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
C=CCOC[C@@H](O)COP(=O)(O)O
|
| ZINC5426687 ZINC | 0.533 | 212.1 Da LogP -0.34 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
C=CCOC[C@H](O)COP(=O)(O)O
|
| ZINC100067589 ZINC | 0.531 | 334.2 Da LogP -4.34 TPSA 197.4 | 1 viol. | ✓ Clean |
O=[P@@](O)(OC[C@H](O)CO)O[C@H]1[C@H](O)[C@@H](O…
|
| ZINC100620818 ZINC | 0.531 | 334.2 Da LogP -4.34 TPSA 197.4 | 1 viol. | ✓ Clean |
O=[P@@](O)(OC[C@H](O)CO)O[C@H]1[C@@H](O)[C@@H](…
|
| ZINC1532714 ZINC | 0.515 | 258.2 Da LogP -0.82 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
C[N+](C)(C)CCO[P@@](=O)(O)OC[C@H](O)CO
|
| ZINC1842903 ZINC | 0.515 | 258.2 Da LogP -0.82 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
C[N+](C)(C)CCO[P@](=O)(O)OC[C@@H](O)CO
|
| ZINC1529626 ZINC | 0.500 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C(CO)[C@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC1532567 ZINC | 0.500 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C(CO)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC1532851 ZINC | 0.500 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C(CO)[C@@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC30320708 ZINC | 0.500 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C(CO)[C@@H](O)[C@H](O)COP(=O)(O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.