KpKP13 Protein target profile

putative endonuclease 4

Accession: KP13_04416

Gene: nfo AHE43565.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GQY5
Length 277
Pocket druggability (P2Rank · AlphaFold DB model) 0.755
Direct ligand evidence 0 115 total records
Functional annotation 1 EC 7 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
10.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
97.54 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.755
Structure A0A0H3GQY5
Pocket Pocket 1
Druggability (FPocket) 0.69
Structure A0A0H3GQY5
Pocket Pocket 1
ColabFold model
P2Rank 0.87 · Pocket 1
FPocket 0.612 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 480 / 4744 genomes with a hit
Prevalence 10.1%

Sequence

Primary amino-acid sequence viewer.

MSASGGLANAAIRAAEIEATAFALFTKNQRQWRAAPLSDETIAEFKAACEKYHFGPGQILPHDSYLINLGHPVEEALEKSRDAFIDEMTRCQQLGLTLLNFHPGSHLQQIPEEECLARIAESINIALAKTEGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRSAEACEKTFAAFERIVGFQYLRGMHLNDAKSAFGSRVDRHHSLGEGNIGHDCFSWIMQDSRFDGIPLILETINPDIWAEEIAWLRAQQIAEVA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 7 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

7
  • GO:0008270 Binding to a zinc ion (Zn).
  • GO:0006281 The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0008833 Catalysis of the endonucleolytic cleavage to 5'-phosphooligonucleotide end-products.
  • GO:0003906 Catalysis of the cleavage of the C-O-P bond in the AP site created when DNA glycosylase removes a damaged base, involved in the DNA base excision repair pathway (BER).
  • GO:0008081 Catalysis of the hydrolysis of a phosphodiester to give a phosphomonoester and a free hydroxyl group.
  • GO:0006284 In base excision repair, an altered base is removed by a DNA glycosylase enzyme, followed by excision of the resulting sugar phosphate. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

24 records
Show feature table
Start End DB Term Name
13 270 Pfam PF01261 Xylose isomerase-like TIM barrel
13 270 InterPro IPR013022 Xylose isomerase-like, TIM barrel domain
62 70 ProSitePatterns PS00729 AP endonucleases family 2 signature 1.
62 70 InterPro IPR018246 AP endonuclease 2, zinc binding site
168 175 ProSitePatterns PS00730 AP endonucleases family 2 signature 2.
168 175 InterPro IPR018246 AP endonuclease 2, zinc binding site
1 277 Gene3D G3DSA:3.20.20.150 -
1 273 ProSiteProfiles PS51432 AP endonucleases family 2 profile.
1 273 InterPro IPR001719 AP endonuclease 2
1 270 PANTHER PTHR21445 ENDONUCLEASE IV ENDODEOXYRIBONUCLEASE IV
1 270 InterPro IPR001719 AP endonuclease 2
208 224 ProSitePatterns PS00731 AP endonucleases family 2 signature 3.
208 224 InterPro IPR018246 AP endonuclease 2, zinc binding site
1 269 NCBIfam TIGR00587 deoxyribonuclease IV
1 269 InterPro IPR001719 AP endonuclease 2
2 270 SUPERFAMILY SSF51658 Xylose isomerase-like
2 270 InterPro IPR036237 Xylose isomerase-like superfamily
2 269 CDD cd00019 AP2Ec
2 269 InterPro IPR001719 AP endonuclease 2
1 272 SMART SM00518 ap2real3
1 272 InterPro IPR001719 AP endonuclease 2
1 277 FunFam G3DSA:3.20.20.150:FF:000001 Probable endonuclease 4
2 272 Hamap MF_00152 Probable endonuclease 4 [nfo].
2 272 InterPro IPR001719 AP endonuclease 2

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.755
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.516
Likely same site as FPocket 1 3.1 Å 17 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.027
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.003
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.69 Unusual size
Likely same site as P2Rank 2 3.1 Å 17 shared residues 100% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:102-102
UniProt: Binding site:138-138
UniProt: Binding site:172-172
UniProt: Binding site:175-175
UniProt: Binding site:209-209
UniProt: Binding site:222-222
UniProt: Binding site:224-224
UniProt: Binding site:254-254
UniProt: Binding site:62-62
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GQY5
AlphaFold DB full sequence Viewing
ColabFold KP13_04416
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

115 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 65 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 64 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
CAC PDB via homolog 137.0 Da · LogP -0.52 · TPSA 40.1 Open detail RCSB PDB
CHEMBL1200993 ChEMBL via homolog · pchembl 8.55 (~2.8 nM) Detail ChEMBL
CHEMBL1333622 ChEMBL via homolog · pchembl 8.55 (~2.8 nM) Detail ChEMBL
CHEMBL1556000 ChEMBL via homolog · pchembl 8.55 (~2.8 nM) Detail ChEMBL
XAC ChEMBL via homolog · pchembl 8.55 (~2.8 nM) Detail ChEMBL

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
CAC RCSB PDB Q5KX27 137.0 Da LogP -0.52 TPSA 40.1 ✓ Ro5 ✓ Clean C[As](=O)(C)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.