Protein target profile

KP13_31534

6-phosphogluconate dehydrogenase, decarboxylating

Genome: KpKP13 Gene: gnd AHE43663.1 3D evidence: Experimental + ColabFold model UniProt A0A0J9WZ66
Length 468
Pocket druggability 0.687
Direct ligand evidence 0 61 total records
Functional annotation 1 EC 5 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
58.163 Lower values reduce human off-target concern.
Human E-value
4.94e-76
Gut microbiome similarity
13.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
85.501 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
98.05 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

PDB experimental structure

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.687
Structure 2ZYG
Pocket Pocket 23
P2Rank 0.331
Structure 2ZYG
Pocket Pocket 1
ColabFold model
FPocket 0.402 · Pocket 12
P2Rank 0.35 · Pocket 1
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 634 / 4744 genomes with a hit
Prevalence 13.4%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Structure

Sequence

Primary amino-acid sequence viewer.

MSKQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEVIAENSGKKLVPYYTVQEFVESLETPRRILLMVKAGAGTDSAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILKQIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYALLKGGLALSNEELAQTFTEWNEGELSSYLIDITKDIFTKKDDEGKYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASDEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAQNADIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEWLD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0050661 Binding to nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NADP+, or the reduced form, NADPH.
  • GO:0004616 Catalysis of the reaction: 6-phospho-D-gluconate + NADP+ = D-ribulose 5-phosphate + CO2 + NADPH + H+.
  • GO:0006098 The metabolic process in which glucose-6-phosphate is oxidized to form carbon dioxide (CO2) and ribulose 5-phosphate, coupled to reduction of NADP+ to NADPH; ribulose 5-P then enters a series of reactions that can yield biosynthetic precursors (ribose-5-phosphate and erythrose-4-phosphate) and glycolytic intermediates (fructose-6-phosphate and glyceraldehyde-3-phosphate).
  • GO:0019521 The chemical reactions and pathways involving D-gluconate, the anion of D-gluconic acid, the aldonic acid derived from glucose.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

37 records
Show feature table
Start End DB Term Name
179 466 Pfam PF00393 6-phosphogluconate dehydrogenase, C-terminal domain
179 466 InterPro IPR006114 6-phosphogluconate dehydrogenase, C-terminal
177 467 SUPERFAMILY SSF48179 6-phosphogluconate dehydrogenase C-terminal domain-like
177 467 InterPro IPR008927 6-phosphogluconate dehydrogenase-like, C-terminal domain superfamily
1 468 PIRSF PIRSF000109 6PGD
1 468 InterPro IPR006113 6-phosphogluconate dehydrogenase, decarboxylating
253 265 ProSitePatterns PS00461 6-phosphogluconate dehydrogenase signature.
253 265 InterPro IPR006184 6-phosphogluconate-binding site
5 467 NCBIfam TIGR00873 decarboxylating NADP(+)-dependent phosphogluconate dehydrogenase
5 467 InterPro IPR006113 6-phosphogluconate dehydrogenase, decarboxylating
181 434 Gene3D G3DSA:1.10.1040.10 -
181 434 InterPro IPR013328 6-phosphogluconate dehydrogenase, domain 2
5 174 Pfam PF03446 NAD binding domain of 6-phosphogluconate dehydrogenase
5 174 InterPro IPR006115 6-phosphogluconate dehydrogenase, NADP-binding
1 180 Gene3D G3DSA:3.40.50.720 -
3 467 PANTHER PTHR11811 6-PHOSPHOGLUCONATE DEHYDROGENASE
3 467 InterPro IPR006183 6-phosphogluconate dehydrogenase
435 468 FunFam G3DSA:1.20.5.320:FF:000001 6-phosphogluconate dehydrogenase, decarboxylating
179 467 SMART SM01350 6PGD_2
179 467 InterPro IPR006114 6-phosphogluconate dehydrogenase, C-terminal
66 95 PRINTS PR00076 6-phosphogluconate dehydrogenase signature
66 95 InterPro IPR006183 6-phosphogluconate dehydrogenase
168 196 PRINTS PR00076 6-phosphogluconate dehydrogenase signature
168 196 InterPro IPR006183 6-phosphogluconate dehydrogenase
249 276 PRINTS PR00076 6-phosphogluconate dehydrogenase signature
249 276 InterPro IPR006183 6-phosphogluconate dehydrogenase
4 27 PRINTS PR00076 6-phosphogluconate dehydrogenase signature
4 27 InterPro IPR006183 6-phosphogluconate dehydrogenase
119 144 PRINTS PR00076 6-phosphogluconate dehydrogenase signature
119 144 InterPro IPR006183 6-phosphogluconate dehydrogenase
356 378 PRINTS PR00076 6-phosphogluconate dehydrogenase signature
356 378 InterPro IPR006183 6-phosphogluconate dehydrogenase
181 434 FunFam G3DSA:1.10.1040.10:FF:000002 6-phosphogluconate dehydrogenase, decarboxylating
435 467 Gene3D G3DSA:1.20.5.320 -
2 180 FunFam G3DSA:3.40.50.720:FF:000007 6-phosphogluconate dehydrogenase, decarboxylating
4 173 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
4 173 InterPro IPR036291 NAD(P)-binding domain superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #23
0.687
Show in viewer
Surrounding area
Site 2 FPocket #2
0.418
Show in viewer
Surrounding area
Site 3 FPocket #3
0.241
Likely same site as P2Rank 1 4.5 Å 13 shared residues 76% of smaller site
Unusual size
Show in viewer
Surrounding area
Site 4 FPocket #15
0.203
Likely same site as P2Rank 4 1.4 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.331
Likely same site as FPocket 3 4.5 Å 13 shared residues 76% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.159
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.117
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.069
Likely same site as FPocket 15 1.4 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.021
Show in viewer
Surrounding area
All structural evidence 1 experimental · 1 predicted

Structural evidence

1 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 2ZYG
X-ray 2.10 Å A,B
100.0% 1-468
Viewing
ColabFold KP13_31534
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

61 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 11 records from similar proteins
Structural ligands 7 0 loaded crystals
Measured bioactivity 4 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
2AM PDB via homolog 347.2 Da · LogP -1.86 · TPSA 186.1 Open detail RCSB PDB
3PG PDB via homolog Detail RCSB PDB
6PG PDB via homolog Detail RCSB PDB
8HS PDB via homolog Detail RCSB PDB
ATR PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
2AM RCSB PDB P00349 347.2 Da LogP -1.86 TPSA 186.1 ✓ Ro5 ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
3PG RCSB PDB P52209 186.1 Da LogP -1.46 TPSA 124.3 ✓ Ro5 ✓ Clean C([C@H](C(=O)O)O)OP(=O)(O)O
6PG RCSB PDB P00350 276.1 Da LogP -3.38 TPSA 185.0 1 viol. ✓ Clean C([C@H]([C@H]([C@@H]([C@H](C(=O)O)O)O)O)O)OP(=O…
8HS RCSB PDB P52209 271.2 Da LogP -0.88 TPSA 134.6 ✓ Ro5 ✓ Clean CC1(O[C@@H]([C@@H](O1)C(=O)NO)COP(=O)(O)O)C
ATR RCSB PDB P00350 507.2 Da LogP -1.63 TPSA 279.1 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
NBP RCSB PDB P00349 822.3 Da LogP -2.77 TPSA 367.6 3 viol. ✓ Clean c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO[P…
POP RCSB PDB P00349 176.0 Da LogP -2.08 TPSA 129.9 ✓ Ro5 ✓ Clean O[P@@](=O)([O-])O[P@@](=O)(O)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.