KpKP13 Protein target profile
dTDP-4-dehydrorhamnose 3,5-epimerase in cps region
Accession: KP13_03795
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 32.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 64.481 Higher values support similarity to known essential genes.
- DEG E-value
- 1.24e-82 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 97.83 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MNIIKTDIPDVLIFEPRVFGDARGFFFESFSSKVFNEAVGRQVDFVQDNHSQSQKGVLRGLHYQLDPHAQGKLVRCVEGEVFDVAVDIRRSSPTFGKWVGAVLSAENKRQLWIPEGFAHGFMALSDTVQFVYKATNYYAPQSERSIIWNDPEIGIDWPALGDCALSLSEKDLQAHTLATAEVYK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Enzyme Commission (EC)
1Gene Ontology (GO)
4- GO:0008830 Catalysis of the reaction: dTDP-4-dehydro-6-deoxy-alpha-D-glucose = dTDP-4-dehydro-6-deoxy-L-mannose.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0019305 The chemical reactions and pathways resulting in the formation of dTDP-rhamnose, a substance composed of rhamnose in glycosidic linkage with deoxyribosylthymine diphosphate.
- GO:0000271 The chemical reactions and pathways resulting in the formation of a polysaccharide, a polymer of many (typically more than 10) monosaccharide residues linked glycosidically.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 5 | 178 | Pfam | PF00908 | dTDP-4-dehydrorhamnose 3,5-epimerase |
| 5 | 178 | InterPro | IPR000888 | dTDP-4-dehydrorhamnose 3,5-epimerase-related |
| 2 | 180 | NCBIfam | TIGR01221 | dTDP-4-dehydrorhamnose 3,5-epimerase |
| 2 | 180 | InterPro | IPR000888 | dTDP-4-dehydrorhamnose 3,5-epimerase-related |
| 2 | 178 | PANTHER | PTHR21047 | DTDP-6-DEOXY-D-GLUCOSE-3,5 EPIMERASE |
| 2 | 178 | InterPro | IPR000888 | dTDP-4-dehydrorhamnose 3,5-epimerase-related |
| 1 | 184 | Gene3D | G3DSA:2.60.120.10 | Jelly Rolls |
| 1 | 184 | InterPro | IPR014710 | RmlC-like jelly roll fold |
| 3 | 174 | CDD | cd00438 | cupin_RmlC |
| 3 | 174 | InterPro | IPR000888 | dTDP-4-dehydrorhamnose 3,5-epimerase-related |
| 1 | 181 | SUPERFAMILY | SSF51182 | RmlC-like cupins |
| 1 | 181 | InterPro | IPR011051 | RmlC-like cupin domain superfamily |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GSI9
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_03795
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| ATY RCSB PDB | P26394 | 444.2 Da LogP -0.71 TPSA 203.7 | ✓ Ro5 | ✓ Clean |
CC1=CN(C(=O)NC1=O)[C@H]2C[C@@H]([C@H](O2)CO[P@@…
|
|
| SRT RCSB PDB | Q9HU21 | 150.1 Da LogP -2.12 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
[C@H]([C@H](C(=O)O)O)(C(=O)O)O
|
|
| TDO RCSB PDB | Q5ZXH5 | 546.3 Da LogP -2.22 TPSA 253.4 | 3 viol. | ✓ Clean |
C[C@H]1C(=O)[C@H]([C@H]([C@H](O1)O[P@@](=O)(O)O…
|
|
| TPE RCSB PDB | P26394 | 520.3 Da LogP 1.38 TPSA 192.7 | 2 viol. | ✓ Clean |
CC1=CN(C(=O)NC1=O)[C@H]2C[C@@H]([C@H](O2)CO[P@@…
|
|
| TYD RCSB PDB | O27818 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
CC1=CN(C(=O)NC1=O)[C@H]2C[C@@H]([C@H](O2)CO[P@]…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL592712 ChEMBL | P9WH10 | 7.21 ~61.7 nM | 416.5 Da LogP 3.99 TPSA 81.4 | ✓ Ro5 | ✓ Clean |
C=CCn1c2ccccc2c2nnc(SCCCn3c(=O)[nH]c4ccccc43)nc…
|
| CHEMBL589101 ChEMBL | P9WH10 | 7.00 ~100.0 nM | 404.5 Da LogP 3.82 TPSA 81.4 | ✓ Ro5 | ✓ Clean |
CCn1c2ccccc2c2nnc(SCCCn3c(=O)[nH]c4ccccc43)nc21
|
| CHEMBL590576 ChEMBL | P9WH10 | 6.40 ~398.1 nM | 448.5 Da LogP 2.67 TPSA 115.5 | ✓ Ro5 | ✓ Clean |
C=CCn1c2ccccc2c2nnc(S(=O)(=O)CCCn3c(=O)[nH]c4cc…
|
| CHEMBL592545 ChEMBL | P9WH10 | 6.30 ~501.2 nM | 390.5 Da LogP 3.34 TPSA 81.4 | ✓ Ro5 | ✓ Clean |
Cn1c2ccccc2c2nnc(SCCCn3c(=O)[nH]c4ccccc43)nc21
|
| CHEMBL600648 ChEMBL | P9WH10 | 6.10 ~794.3 nM | 436.5 Da LogP 2.51 TPSA 115.5 | ✓ Ro5 | ✓ Clean |
CCn1c2ccccc2c2nnc(S(=O)(=O)CCCn3c(=O)[nH]c4cccc…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC18094029 ZINC | 1.000 | 404.5 Da LogP 3.82 TPSA 81.4 | ✓ Ro5 | ✓ Clean |
CCn1c2ccccc2c2nnc(SCCCn3c(=O)[nH]c4ccccc43)nc21
|
| ZINC18322375 ZINC | 1.000 | 416.5 Da LogP 3.99 TPSA 81.4 | ✓ Ro5 | ✓ Clean |
C=CCn1c2ccccc2c2nnc(SCCCn3c(=O)[nH]c4ccccc43)nc…
|
| ZINC33979243 ZINC | 1.000 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC2751170 ZINC | 0.875 | 418.5 Da LogP 4.21 TPSA 81.4 | ✓ Ro5 | ✓ Clean |
CCCn1c2ccccc2c2nnc(SCCCn3c(=O)[nH]c4ccccc43)nc21
|
| ZINC2745826 ZINC | 0.821 | 390.5 Da LogP 3.34 TPSA 81.4 | ✓ Ro5 | ✓ Clean |
Cn1c2ccccc2c2nnc(SCCCn3c(=O)[nH]c4ccccc43)nc21
|
| ZINC2995449 ZINC | 0.810 | 466.6 Da LogP 4.85 TPSA 81.4 | ✓ Ro5 | ✓ Clean |
O=c1[nH]c2ccccc2n1CCCSc1nnc2c3ccccc3n(Cc3ccccc3…
|
| ZINC13507072 ZINC | 0.719 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)O[P@…
|
| ZINC33979251 ZINC | 0.719 | 482.2 Da LogP -1.16 TPSA 244.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC12503053 ZINC | 0.714 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC33979244 ZINC | 0.714 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)OP(=O)…
|
| ZINC33979245 ZINC | 0.714 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)OP(=…
|
| ZINC33979246 ZINC | 0.714 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@@H](O)[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC8215882 ZINC | 0.714 | 402.2 Da LogP -1.28 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC6455268 ZINC | 0.695 | 376.4 Da LogP 3.33 TPSA 92.2 | ✓ Ro5 | ✓ Clean |
O=c1[nH]c2ccccc2n1CCCSc1nnc2c(n1)[nH]c1ccccc12
|
| ZINC12359024 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC13533920 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC1532740 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC1549593 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC2013424 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC3581021 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC3860635 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC5783661 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC6072527 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC2869073 ZINC | 0.673 | 286.4 Da LogP 3.89 TPSA 43.6 | ✓ Ro5 | ✓ Clean |
CCCCSc1nnc2c3ccccc3n(CC)c2n1
|
| ZINC13523519 ZINC | 0.651 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@@H](COP(=O)(O)O)O2)c(…
|
| ZINC1532628 ZINC | 0.651 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](COP(=O)(O)O)O2)c(=…
|
| ZINC1678872 ZINC | 0.651 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@@H](COP(=O)(O)O)O2)c(=O…
|
| ZINC2047010 ZINC | 0.651 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@@H](O)[C@H](COP(=O)(O)O)O2)c(=O…
|
| ZINC3870253 ZINC | 0.651 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](COP(=O)(O)O)O2)c(=O…
|
| ZINC3870254 ZINC | 0.651 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@H]2C[C@H](O)[C@H](COP(=O)(O)O)O2)c(=O)…
|
| ZINC6523446 ZINC | 0.651 | 322.2 Da LogP -1.40 TPSA 151.1 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@@H](COP(=O)(O)O)O2)c(=…
|
| ZINC12763633 ZINC | 0.646 | 392.5 Da LogP 3.41 TPSA 72.7 | ✓ Ro5 | ✓ Clean |
C=CCn1c(SCCCn2c(=O)[nH]c3ccccc32)nc2ccccc2c1=O
|
| ZINC2779918 ZINC | 0.636 | 272.4 Da LogP 3.50 TPSA 43.6 | ✓ Ro5 | ✓ Clean |
CCCSc1nnc2c3ccccc3n(CC)c2n1
|
| ZINC2774660 ZINC | 0.633 | 284.4 Da LogP 3.67 TPSA 43.6 | ✓ Ro5 | ✓ Clean |
C=CCn1c2ccccc2c2nnc(SCCC)nc21
|
| ZINC2446819 ZINC | 0.632 | 334.4 Da LogP 4.33 TPSA 43.6 | ✓ Ro5 | ✓ Clean |
CCn1c2ccccc2c2nnc(SCCc3ccccc3)nc21
|
| ZINC5490587 ZINC | 0.627 | 297.4 Da LogP 3.40 TPSA 67.4 | ✓ Ro5 | ✓ Clean |
CCn1c2ccccc2c2nnc(SCCCC#N)nc21
|
| ZINC6702687 ZINC | 0.619 | 314.4 Da LogP 2.73 TPSA 80.9 | ✓ Ro5 | ✓ Clean |
C=CCn1c2ccccc2c2nnc(SCCC(=O)O)nc21
|
| ZINC111459735 ZINC | 0.614 | 481.2 Da LogP -1.20 TPSA 249.9 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](N)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC138164075 ZINC | 0.614 | 498.2 Da LogP 0.21 TPSA 227.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC6979742 ZINC | 0.614 | 274.3 Da LogP 2.08 TPSA 63.8 | ✓ Ro5 | ✓ Clean |
CCn1c2ccccc2c2nnc(SCCO)nc21
|
| ZINC2188705 ZINC | 0.610 | 282.4 Da LogP 3.44 TPSA 43.6 | ✓ Ro5 | ✓ Clean |
C=CCSc1nnc2c3ccccc3n(CC=C)c2n1
|
| ZINC176086 ZINC | 0.607 | 332.4 Da LogP 4.46 TPSA 43.6 | ✓ Ro5 | ✓ Clean |
C=CCn1c2ccccc2c2nnc(SCc3ccccc3)nc21
|
| ZINC17107637 ZINC | 0.606 | 320.2 Da LogP -1.46 TPSA 162.7 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@@H](COP(N)(N)=O)O2)c(…
|
| ZINC17107641 ZINC | 0.606 | 320.2 Da LogP -1.46 TPSA 162.7 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@@H](COP(N)(N)=O)O2)c(=…
|
| ZINC5493427 ZINC | 0.606 | 320.2 Da LogP -1.46 TPSA 162.7 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](COP(N)(N)=O)O2)c(=O…
|
| ZINC5493430 ZINC | 0.606 | 320.2 Da LogP -1.46 TPSA 162.7 | ✓ Ro5 | ✓ Clean |
Cc1cn([C@@H]2C[C@@H](O)[C@H](COP(N)(N)=O)O2)c(=…
|
| ZINC142512519 ZINC | 0.600 | 498.2 Da LogP 0.21 TPSA 227.1 | 2 viol. | ✓ Clean |
Cc1cn([C@@H]2C[C@H](O)[C@H](CO[P@@](=O)(O)O[P@@…
|
| ZINC176091 ZINC | 0.600 | 258.4 Da LogP 3.11 TPSA 43.6 | ✓ Ro5 | ✓ Clean |
CCSc1nnc2c3ccccc3n(CC)c2n1
|
| ZINC446033 ZINC | 0.600 | 270.4 Da LogP 3.28 TPSA 43.6 | ✓ Ro5 | ✓ Clean |
C=CCn1c2ccccc2c2nnc(SCC)nc21
|
| ZINC856931 ZINC | 0.600 | 353.5 Da LogP 3.74 TPSA 46.8 | ✓ Ro5 | ✓ Clean |
C=CCn1c2ccccc2c2nnc(SCCN3CCCCC3)nc21
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.