KpKP13 Protein target profile

thiazolinyl-S-HMWP1 reductase

Accession: KP13_04824

Gene: AHE43791.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GVL9
Length 366
Pocket druggability (P2Rank · AlphaFold DB model) 0.795
Direct ligand evidence 0 12 total records
Functional annotation 0 EC 1 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
96.03 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.795
Structure A0A0H3GVL9
Pocket Pocket 1
Druggability (FPocket) 0.542
Structure A0A0H3GVL9
Pocket Pocket 26
ColabFold model
P2Rank 0.68 · Pocket 1
FPocket 0.371 · Pocket 21
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 4 / 4744 genomes with a hit
Prevalence 0.1%

Sequence

Primary amino-acid sequence viewer.

MMPSASPKQRVLIVGAKFGEMYLNAFMQPPEGLELVGLLAQGSARSRELAHAFGIPLYTSPEQITRMPDIACIVVRSTVAGGTGTQLARHFLTRGVHVIQEHPLHPDDISSLQTLAQEQGCCYWVNTFYPHTRAGRTWLRDAQQLRRCLAKTPPVVHATTSRQLLYSTLDLLLLALGVDAAAVECDVVGSFSDFHCLRLFWPEGEACLLLQRYLDPDDPDMHSLIMHRLLLGWPEGHLSLEASYGPVIWSSSLFVADHQENAHSLYRRPEILRDLPGLTRSAAPLSWRDCCETVGPEGVSWLLHQLCSHLAGEHPPAACQSVHQIALSRLWQQILRKTGNAEIRRLTPPHHDRLAGFYNDDDKEAL

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

1
  • GO:0000166 Binding to a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

11 records
Show feature table
Start End DB Term Name
267 366 Gene3D G3DSA:3.40.50.720 -
6 188 Gene3D G3DSA:3.40.50.720 -
4 148 PANTHER PTHR43377 BILIVERDIN REDUCTASE A
4 363 PIRSF PIRSF017494 Thiazolinyl_imide_reduct_YbtU
4 363 InterPro IPR010091 Thiazolinyl imide reductase
6 348 NCBIfam TIGR01761 thiazolinyl imide reductase
6 348 InterPro IPR010091 Thiazolinyl imide reductase
10 126 Pfam PF01408 Oxidoreductase family, NAD-binding Rossmann fold
10 126 InterPro IPR000683 Gfo/Idh/MocA-like oxidoreductase, N-terminal
8 140 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
8 140 InterPro IPR036291 NAD(P)-binding domain superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.795
Likely same site as FPocket 26 4.5 Å 20 shared residues 74% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.326
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.16
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.142
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.045
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #26
0.542 Unusual size
Likely same site as P2Rank 1 4.5 Å 20 shared residues 74% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GVL9
AlphaFold DB full sequence Viewing
ColabFold KP13_04824
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

12 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 1 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 11 similarity-based ZINC candidates
Best available ligand signal
6XR PDB via homolog 306.4 Da · LogP 2.46 · TPSA 82.8 Open detail RCSB PDB
ZINC84428709 ZINC proposed compound · Tanimoto 0.744 Detail ZINC
ZINC87530989 ZINC proposed compound · Tanimoto 0.744 Detail ZINC
ZINC19735671 ZINC proposed compound · Tanimoto 0.585 Detail ZINC
ZINC19735672 ZINC proposed compound · Tanimoto 0.585 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
6XR RCSB PDB O54512 306.4 Da LogP 2.46 TPSA 82.8 ✓ Ro5 ✓ Clean c1ccc(c(c1)c2nc(cs2)C3=N[C@@H](CS3)C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.