KpKP13 Protein target profile

Tyrosine-specific transport protein

Accession: KP13_13083

Gene: ANJ86600.1 tyrP 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GVK1
Length 403
Pocket druggability (P2Rank · AlphaFold DB model) 0.868
Functional annotation 0 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
80.893 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
90.39 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.868
Structure A0A0H3GVK1
Pocket Pocket 1
Druggability (FPocket) 0.984
Structure A0A0H3GVK1
Pocket Pocket 12
ColabFold model
P2Rank 0.894 · Pocket 1
FPocket 0.952 · Pocket 8
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 104 / 4744 genomes with a hit
Prevalence 2.2%

Sequence

Primary amino-acid sequence viewer.

MKNRTLGSILIVAGTTIGAGMLAMPLAAAGVGFTVTLGLLFTLWALMCYTALLLLEVYQHVPADMGLGSLAARYLGRYGQWVTGFCMLFLLYALTAAYISGAGELLASSLNQWLDWQLPPAAGVLIFTLLGGAVVCIGTALVDLFNRFLFSAKIVFLVIMLALLMPHIHQVNLLTLPVEQGLALSAIPVIFTSFGFHGSVPSIVSYLGGDIRKLRRVFIIGSFIPLVAYIFWQLATLGSIDAPAFTALLANNAGLNGLLEAIREVVASPHVELAVHLFADLALATSFLGVSLGLFDYLADMFQRKNSVGGRLQSGIITFLPPLAFALFYPRGFVMALGYAGVALAVLALIMPALLVMKSRREHPQATWRVAGGAPTLWLVLLCGIGIVAIQFSIAAGLLPAVG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

5
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0015801 The directed movement of aromatic amino acids, amino acids with aromatic ring, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0003333 The process in which an amino acid is transported across a membrane.
  • GO:0015173 Enables the transfer of aromatic amino acids from one side of a membrane to the other. Aromatic amino acids have an aromatic ring.
  • GO:0015293 Enables the active transport of a solute across a membrane by a mechanism whereby two or more species are transported together in the same direction in a tightly coupled process not directly linked to a form of energy other than chemiosmotic energy.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

64 records
Show feature table
Start End DB Term Name
30 38 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
357 376 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
39 58 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
170 180 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
316 334 PRINTS PR00166 Aromatic amino acid permease signature
316 334 InterPro IPR013059 Tryptophan/tyrosine transporter
148 168 PRINTS PR00166 Aromatic amino acid permease signature
148 168 InterPro IPR013059 Tryptophan/tyrosine transporter
37 56 PRINTS PR00166 Aromatic amino acid permease signature
37 56 InterPro IPR013059 Tryptophan/tyrosine transporter
182 204 PRINTS PR00166 Aromatic amino acid permease signature
182 204 InterPro IPR013059 Tryptophan/tyrosine transporter
221 240 PRINTS PR00166 Aromatic amino acid permease signature
221 240 InterPro IPR013059 Tryptophan/tyrosine transporter
337 356 PRINTS PR00166 Aromatic amino acid permease signature
337 356 InterPro IPR013059 Tryptophan/tyrosine transporter
10 33 PRINTS PR00166 Aromatic amino acid permease signature
10 33 InterPro IPR013059 Tryptophan/tyrosine transporter
282 301 PRINTS PR00166 Aromatic amino acid permease signature
282 301 InterPro IPR013059 Tryptophan/tyrosine transporter
82 102 PRINTS PR00166 Aromatic amino acid permease signature
82 102 InterPro IPR013059 Tryptophan/tyrosine transporter
121 141 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
400 403 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
7 384 NCBIfam TIGR00837 aromatic amino acid transporter
7 384 InterPro IPR013059 Tryptophan/tyrosine transporter
186 208 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
205 215 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
149 171 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
217 236 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
236 272 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
7 29 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
17 33 ProSitePatterns PS00594 Aromatic amino acids permeases signature.
17 33 InterPro IPR013061 Tryptophan/tryrosine permease, conserved site
18 29 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
181 204 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
59 77 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
2 400 FunFam G3DSA:1.20.1740.10:FF:000032 Tyrosine-specific transport system
1 29 Phobius SIGNAL_PEPTIDE Signal peptide region
2 390 Pfam PF03222 Tryptophan/tyrosine permease family
2 390 InterPro IPR018227 Amino acid/polyamine transporter 2
311 330 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
216 235 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
307 329 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 5 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
33 55 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
2 402 PANTHER PTHR46997 LOW AFFINITY TRYPTOPHAN PERMEASE-RELATED
2 402 InterPro IPR013059 Tryptophan/tyrosine transporter
78 101 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
377 399 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
273 299 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
6 17 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
78 100 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
273 295 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
300 310 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
120 142 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
331 335 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
336 356 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
377 399 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
2 402 Gene3D G3DSA:1.20.1740.10 Amino acid/polyamine transporter I
142 147 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
148 169 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
334 356 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
102 120 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.868
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.584
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.318
Likely same site as FPocket 3 0.9 Å 8 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.223
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.144
Likely same site as FPocket 12 3.6 Å 11 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #12
0.984 Unusual size
Likely same site as P2Rank 5 3.6 Å 11 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #26
0.279
Show in viewer
Surrounding area
Pocket 3 FPocket #3
0.224
Likely same site as P2Rank 3 0.9 Å 8 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GVK1
AlphaFold DB full sequence Viewing
ColabFold KP13_13083
ColabFold full sequence Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.