KpKP13 Protein target profile

Threonine/serine transporter tdcC

Accession: KP13_01532

Gene: AHE43939.1 tdcC 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GZU9
Length 443
Pocket druggability (P2Rank · AlphaFold DB model) 0.18
Functional annotation 0 EC 11 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
44.056 Higher values support similarity to known essential genes.
DEG E-value
2.4599999999999998e-114 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
86.83 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.18
Structure A0A0H3GZU9
Pocket Pocket 1
Druggability (FPocket) 0.843
Structure A0A0H3GZU9
Pocket Pocket 10
ColabFold model
P2Rank 0.787 · Pocket 1
FPocket 0.443 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 92 / 4744 genomes with a hit
Prevalence 1.9%

Sequence

Primary amino-acid sequence viewer.

MSTTESIASSQTSLSSWRKSDTTWTLGLFGTAIGAGVLFFPIRAGFGGLIPILVMLVLAYPIAFYCHRALARLCLSGANPSGNITETVEEHFGKTGGVVITFLYFFAICPLLWIYGVTITNTFMTFWENQLQMPALNRGVVALLLLLLMAFVIWFGKDLMVKVMSYLVWPFIASLVVISLSLIPYWNSAVIDQVNLSDIALTGHDGILVTVWLGISIMVFSFNFSPIVSSFVVSKREEYEAQFGREYTERKCSQIISRASMLMVAVVMFFAFSCLFTLSPQNMADAKAQNIPVLSYLANHFASMSGTKSTFATLLEYGASIIALVAIFKSFFGHYLGTLEGLNGLILRFGYKGDKTRVSSGKLNTLSMVFIMGSTWVVAYANPNILDLIEAMGAPIIASLLCLLPMYAIRKAPSLAKYRGRLDNLFVTAIGLLTILNIAYKLF

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

11 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

11
  • GO:0032329 The directed movement of L-serine, 2-amino-3-hydroxypropanoic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0003333 The process in which an amino acid is transported across a membrane.
  • GO:0022889 OBSOLETE. Enables the transfer of serine from one side of a membrane to the other. Serine is 2-amino-3-hydroxypropanoic acid.
  • GO:0006865 The directed movement of amino acids, organic acids containing one or more amino substituents, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0015565 Enables the transfer of threonine from the inside of the cell to the outside of the cell across a membrane.
  • GO:0015171 Enables the transfer of amino acids from one side of a membrane to the other. Amino acids are organic molecules that contain an amino group and a carboxyl group.
  • GO:0015826 The directed movement of threonine, (2R*,3S*)-2-amino-3-hydroxybutanoic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0015194 Enables the transfer of L-serine from one side of a membrane to the other. L-serine is the L-enantiomer of 2-amino-3-hydroxypropanoic acid.
  • GO:0015293 Enables the active transport of a solute across a membrane by a mechanism whereby two or more species are transported together in the same direction in a tightly coupled process not directly linked to a form of energy other than chemiosmotic energy.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

43 records
Show feature table
Start End DB Term Name
23 42 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
187 205 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
255 278 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
167 186 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
410 420 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
67 95 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
422 440 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
235 254 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
29 417 Pfam PF03222 Tryptophan/tyrosine permease family
29 417 InterPro IPR018227 Amino acid/polyamine transporter 2
1 443 PANTHER PTHR35334 SERINE TRANSPORTER
1 443 InterPro IPR018227 Amino acid/polyamine transporter 2
1 443 Hamap MF_01583 Threonine/serine transporter TdcC [tdcC].
1 443 InterPro IPR023726 Threonine/serine transporter TdcC
383 387 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
441 443 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
212 234 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
23 40 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
390 409 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
44 66 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 22 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
255 277 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
134 156 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
315 337 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
421 440 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
279 316 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
97 119 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
156 166 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
116 134 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
17 433 NCBIfam TIGR00814 serine/threonine transporter
17 433 InterPro IPR004694 Hydroxy amino acid transporter
22 442 Gene3D G3DSA:1.20.1740.10 Amino acid/polyamine transporter I
388 409 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
363 382 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
135 155 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
48 66 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
343 362 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
358 380 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
163 185 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
43 47 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
317 342 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
96 115 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
206 234 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.18
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.065
Likely same site as FPocket 17 2.4 Å 7 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.061
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.049
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.025
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #10
0.843
Show in viewer
Surrounding area
Pocket 2 FPocket #7
0.651
Show in viewer
Surrounding area
Pocket 3 FPocket #4
0.572
Show in viewer
Surrounding area
Pocket 4 FPocket #17
0.373
Likely same site as P2Rank 2 2.4 Å 7 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GZU9
AlphaFold DB full sequence Viewing
ColabFold KP13_01532
ColabFold full sequence Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.