KpKP13 Protein target profile
ABC-type high-affinity branched-chain amino acid transport system
Accession: KP13_01529
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 1.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 92.72 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MTPGFTSLRNIRMSLKLKTMTLHVVIAGCMSMAFYAQADVKIGVAGPFTGPNATYGAQYWKGASQAVADINAAGGIKGEKIVLVQGDDACEPKQAVAVANRLVDEAKVSAVVGHFCSSSTMPASEVYDEAGILTITPGSTNPQITERGMKDLFRMCGRDDQQGAIAANYMLDVLKAKKIAVIHDKDTYGQGLADATRAALAKRGTKEVLYEGLSRGEKDFNALVTKIGALKPDVVYFGGCHPEAGPLVRQMREQGVQAKFFSGDCIVTEELVTAAGGPQFTNGVLMTFGQDPRTLPDGKAVIEKFRASGFEPEGYTLYAYASIQAIAAAWNAVGIDNAKASDWLKSHDVETVMGKKAWDGKGDLKVSDYVVYQWDDKGKYHQL
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Periplasmic
Gene Ontology (GO)
1- GO:0006865 The directed movement of amino acids, organic acids containing one or more amino substituents, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 41 | 362 | Gene3D | G3DSA:3.40.50.2300 | - |
| 21 | 38 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 294 | 307 | PRINTS | PR00337 | Leu/Ile/Val-binding protein family signature |
| 294 | 307 | InterPro | IPR000709 | Leu/Ile/Val-binding protein |
| 40 | 56 | PRINTS | PR00337 | Leu/Ile/Val-binding protein family signature |
| 40 | 56 | InterPro | IPR000709 | Leu/Ile/Val-binding protein |
| 62 | 78 | PRINTS | PR00337 | Leu/Ile/Val-binding protein family signature |
| 62 | 78 | InterPro | IPR000709 | Leu/Ile/Val-binding protein |
| 81 | 99 | PRINTS | PR00337 | Leu/Ile/Val-binding protein family signature |
| 81 | 99 | InterPro | IPR000709 | Leu/Ile/Val-binding protein |
| 344 | 359 | PRINTS | PR00337 | Leu/Ile/Val-binding protein family signature |
| 344 | 359 | InterPro | IPR000709 | Leu/Ile/Val-binding protein |
| 1 | 38 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 40 | 379 | Pfam | PF13458 | Periplasmic binding protein |
| 40 | 379 | InterPro | IPR028081 | Leucine-binding protein domain |
| 159 | 289 | Gene3D | G3DSA:3.40.50.2300 | - |
| 21 | 29 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 1 | 38 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 39 | 380 | SUPERFAMILY | SSF53822 | Periplasmic binding protein-like I |
| 39 | 380 | InterPro | IPR028082 | Periplasmic binding protein-like I |
| 1 | 20 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 1 | 38 | SignalP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM |
| 15 | 382 | PANTHER | PTHR47151 | LEU/ILE/VAL-BINDING ABC TRANSPORTER SUBUNIT |
| 41 | 374 | CDD | cd06342 | PBP1_ABC_LIVBP-like |
| 39 | 383 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 30 | 38 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GZU3
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_01529
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC13357569 ZINC | 0.778 | 243.4 Da LogP 3.71 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCCC(=O)O
|
| ZINC1763117 ZINC | 0.778 | 201.3 Da LogP 2.54 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCC(=O)O
|
| ZINC1845814 ZINC | 0.778 | 215.3 Da LogP 2.93 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCC(=O)O
|
| ZINC22048354 ZINC | 0.778 | 229.4 Da LogP 3.32 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCC(=O)O
|
| ZINC34552398 ZINC | 0.778 | 257.4 Da LogP 4.10 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCCCC(=O)O
|
| ZINC34628306 ZINC | 0.778 | 271.4 Da LogP 4.49 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCCCCC(=O)O
|
| ZINC3074822 ZINC | 0.667 | 229.3 Da LogP 2.11 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
NCCCCCC(=O)CCCCCC(=O)O
|
| ZINC4822737 ZINC | 0.667 | 313.5 Da LogP 4.45 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCC(=O)CCCCCC(=O)O
|
| ZINC1569727 ZINC | 0.593 | 202.3 Da LogP -0.05 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)O
|
| ZINC1569728 ZINC | 0.593 | 202.3 Da LogP -0.05 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@@H](C)C(=O)O
|
| ZINC1569729 ZINC | 0.593 | 202.3 Da LogP -0.05 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@H](C)C(=O)O
|
| ZINC1569730 ZINC | 0.593 | 202.3 Da LogP -0.05 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@H](C)C(=O)O
|
| ZINC1529497 ZINC | 0.588 | 230.3 Da LogP 3.06 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCC(=O)O
|
| ZINC1531045 ZINC | 0.588 | 202.2 Da LogP 2.28 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCC(=O)O
|
| ZINC1593115 ZINC | 0.588 | 216.3 Da LogP 2.67 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCC(=O)O
|
| ZINC1700020 ZINC | 0.588 | 244.3 Da LogP 3.45 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCC(=O)O
|
| ZINC3860440 ZINC | 0.588 | 258.4 Da LogP 3.84 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCC(=O)O
|
| ZINC3861298 ZINC | 0.588 | 286.4 Da LogP 4.62 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCCC(=O)O
|
| ZINC5113062 ZINC | 0.588 | 272.4 Da LogP 4.23 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CCCCCCCCCCCCCC(=O)O
|
| ZINC2522597 ZINC | 0.586 | 246.3 Da LogP -0.60 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](NC(=O)C[C@H](N)C(=O)O)C(=O)O
|
| ZINC40470158 ZINC | 0.577 | 216.3 Da LogP 0.49 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
NCCCC(=O)NCCCCCC(=O)O
|
| ZINC1532219 ZINC | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)O
|
| ZINC1532220 ZINC | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](NC(=O)[C@H](N)CC(C)C)C(=O)O
|
| ZINC1532221 ZINC | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
|
| ZINC1532222 ZINC | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
|
| ZINC64219359 ZINC | 0.565 | 202.3 Da LogP -0.41 TPSA 106.4 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H](C(=O)[C@@H](C)N)[C@H](N)C(=O)O
|
| ZINC64219360 ZINC | 0.565 | 202.3 Da LogP -0.41 TPSA 106.4 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H](C(=O)[C@@H](C)N)[C@H](N)C(=O)O
|
| ZINC78311249 ZINC | 0.565 | 203.3 Da LogP -0.54 TPSA 92.6 | ✓ Ro5 | ✓ Clean |
NCCCN(CCCN)CCC(=O)O
|
| ZINC79670384 ZINC | 0.565 | 202.3 Da LogP -0.41 TPSA 106.4 | ✓ Ro5 | ✓ Clean |
CC(C)[C@@H](C(=O)[C@H](C)N)[C@H](N)C(=O)O
|
| ZINC79670387 ZINC | 0.565 | 202.3 Da LogP -0.41 TPSA 106.4 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H](C(=O)[C@H](C)N)[C@H](N)C(=O)O
|
| ZINC1605717 ZINC | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@H](C(=O)O)C(C)C
|
| ZINC1605718 ZINC | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@H](C(=O)O)C(C)C
|
| ZINC1605719 ZINC | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](C(=O)O)C(C)C
|
| ZINC1605720 ZINC | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@@H](C(=O)O)C(C)C
|
| ZINC13433578 ZINC | 0.550 | 201.3 Da LogP 1.68 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
NC(=O)CCCCCCCCC(=O)O
|
| ZINC201768036 ZINC | 0.542 | 279.3 Da LogP -0.12 TPSA 100.2 | ✓ Ro5 | ✓ Clean |
NCCOCCOCCOCCOCCCC(=O)O
|
| ZINC1616450 ZINC | 0.536 | 254.3 Da LogP -1.28 TPSA 82.3 | ✓ Ro5 | ✓ Clean |
O=C(NCCNC(=O)[C@@H]1CCCN1)[C@@H]1CCCN1
|
| ZINC5600257 ZINC | 0.536 | 254.3 Da LogP -1.28 TPSA 82.3 | ✓ Ro5 | ✓ Clean |
O=C(NCCNC(=O)[C@H]1CCCN1)[C@H]1CCCN1
|
| ZINC8655607 ZINC | 0.536 | 254.3 Da LogP -1.28 TPSA 82.3 | ✓ Ro5 | ✓ Clean |
O=C(NCCNC(=O)[C@H]1CCCN1)[C@@H]1CCCN1
|
| ZINC13529436 ZINC | 0.533 | 212.3 Da LogP 1.76 TPSA 46.3 | ✓ Ro5 | ✓ Clean |
CC[C@H](C)[C@H](N)C(=O)N1CCCCCC1
|
| ZINC1541834 ZINC | 0.533 | 218.3 Da LogP -1.08 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)O
|
| ZINC19502834 ZINC | 0.533 | 212.3 Da LogP 1.76 TPSA 46.3 | ✓ Ro5 | ✓ Clean |
CC[C@@H](C)[C@@H](N)C(=O)N1CCCCCC1
|
| ZINC19502836 ZINC | 0.533 | 212.3 Da LogP 1.76 TPSA 46.3 | ✓ Ro5 | ✓ Clean |
CC[C@H](C)[C@@H](N)C(=O)N1CCCCCC1
|
| ZINC19502838 ZINC | 0.533 | 212.3 Da LogP 1.76 TPSA 46.3 | ✓ Ro5 | ✓ Clean |
CC[C@@H](C)[C@H](N)C(=O)N1CCCCCC1
|
| ZINC227596999 ZINC | 0.533 | 357.5 Da LogP 1.51 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CC…
|
| ZINC227597004 ZINC | 0.533 | 357.5 Da LogP 1.51 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C…
|
| ZINC2556618 ZINC | 0.533 | 246.3 Da LogP -0.60 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](CC(=O)O)C(=O)O
|
| ZINC4556667 ZINC | 0.533 | 357.5 Da LogP 1.51 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@H](CC(C)C)C(=O)N[C@@H](C…
|
| ZINC4556684 ZINC | 0.533 | 218.3 Da LogP -1.08 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@@H](CO)C(=O)O
|
| ZINC4556685 ZINC | 0.533 | 218.3 Da LogP -1.08 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@H](CO)C(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.