Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 37.725 Lower values reduce human off-target concern.
- Human E-value
- 1.78e-31
- Gut microbiome similarity
- 3.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 97.52 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSITIRQATPDDATAIYDMIYELAVYEKAPEEVVTTPEEIRETLFASGSKTEALICEVAGKAVGYAVFFTSYSTWLGRNGIYMEDLYVTPDYRGIGAGKALLKTIAQYAVQRQCGRLEWSVLDWNQPAIDFYLSIGAQPQDEWVRYRLTGDALRAFAE
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
2- GO:0016747 Catalysis of the transfer of an acyl group, other than amino-acyl, from one compound (donor) to another (acceptor).
- GO:0008080 Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 158 | Gene3D | G3DSA:3.40.630.30 | - |
| 1 | 158 | FunFam | G3DSA:3.40.630.30:FF:000064 | GNAT family acetyltransferase |
| 3 | 157 | PANTHER | PTHR10545 | DIAMINE N-ACETYLTRANSFERASE |
| 54 | 118 | CDD | cd04301 | NAT_SF |
| 31 | 133 | Pfam | PF00583 | Acetyltransferase (GNAT) family |
| 31 | 133 | InterPro | IPR000182 | GNAT domain |
| 3 | 150 | SUPERFAMILY | SSF55729 | Acyl-CoA N-acyltransferases (Nat) |
| 3 | 150 | InterPro | IPR016181 | Acyl-CoA N-acyltransferase |
| 3 | 158 | ProSiteProfiles | PS51186 | Gcn5-related N-acetyltransferase (GNAT) domain profile. |
| 3 | 158 | InterPro | IPR000182 | GNAT domain |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GV66
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_01522
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL165579 ChEMBL | P21673 | — | 230.4 Da LogP 0.42 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CC(N)CCNCCCCNCCC(C)N
|
| CHEMBL4446160 ChEMBL | P48026 | — | 230.4 Da LogP 0.42 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CC(CCN)NCCCCNC(C)CCN
|
| CHEMBL4555903 ChEMBL | P21673 | — | 230.4 Da LogP 0.14 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CC(CN)CNCCCCNCC(C)CN
|
| SPM ChEMBL | P48026 | — | 202.3 Da LogP -0.36 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
C(CCNCCCN)CNCCCN
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC3780932 ZINC | 0.813 | 244.4 Da LogP 0.55 TPSA 48.1 | ✓ Ro5 | ✓ Clean |
CCNCCCNCCCNCCCNCC
|
| ZINC3776794 ZINC | 0.765 | 258.5 Da LogP 0.95 TPSA 48.1 | ✓ Ro5 | ✓ Clean |
CCNCCCNCCCCNCCCNCC
|
| ZINC3810809 ZINC | 0.706 | 357.6 Da LogP 2.10 TPSA 60.1 | ✓ Ro5 | ✓ Clean |
CCNCCCCNCCCCNCCCCNCCCCNCC
|
| ZINC5650422 ZINC | 0.706 | 286.5 Da LogP 1.73 TPSA 48.1 | ✓ Ro5 | ✓ Clean |
CCNCCCCNCCCCNCCCCNCC
|
| ZINC100016239 ZINC | 0.700 | 200.4 Da LogP 2.55 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCNCCCNCC
|
| ZINC12359024 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC13533920 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC1532740 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC1549593 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC2013424 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC3581021 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC3860635 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC5783661 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC6072527 ZINC | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC1726574 ZINC | 0.667 | 200.4 Da LogP 2.55 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
CCCNCCCCCCNCCC
|
| ZINC1560405156 ZINC | 0.588 | 208.1 Da LogP -1.79 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)/C(O)=C(\O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC1560405157 ZINC | 0.588 | 208.1 Da LogP -1.79 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)/C(O)=C(/O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC31361891 ZINC | 0.579 | 200.3 Da LogP -0.58 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
NCCCNC/C=C/CNCCCN
|
| ZINC4978005 ZINC | 0.579 | 200.3 Da LogP -0.58 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
NCCCNC/C=C\CNCCCN
|
| ZINC101172865 ZINC | 0.571 | 228.4 Da LogP 3.45 TPSA 38.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC[C@H](C)NCCCN
|
| ZINC101172866 ZINC | 0.571 | 228.4 Da LogP 3.45 TPSA 38.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC[C@@H](C)NCCCN
|
| ZINC169723055 ZINC | 0.565 | 228.3 Da LogP 1.00 TPSA 98.8 | ✓ Ro5 | Alert |
[N-]=[N+]=NCCCNCCCCNCCCN
|
| ZINC27525218 ZINC | 0.545 | 256.4 Da LogP 0.72 TPSA 48.1 | ✓ Ro5 | ✓ Clean |
CCNCCCNC/C=C\CNCCCNCC
|
| ZINC2563384 ZINC | 0.522 | 228.4 Da LogP 3.04 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
CC(C)CNCCCCCCNCC(C)C
|
| ZINC1683332 ZINC | 0.516 | 215.4 Da LogP 1.44 TPSA 41.3 | ✓ Ro5 | ✓ Clean |
CCN(CC)CCC[C@H](C)NCCCN
|
| ZINC2042698 ZINC | 0.516 | 215.4 Da LogP 1.44 TPSA 41.3 | ✓ Ro5 | ✓ Clean |
CCN(CC)CCC[C@@H](C)NCCCN
|
| ZINC100027350 ZINC | 0.500 | 227.4 Da LogP 4.91 TPSA 12.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCNCCCCCCC
|
| ZINC1529331 ZINC | 0.500 | 206.1 Da LogP -2.21 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
O=C(O)C(=O)[C@H](C(=O)O)[C@@H](O)C(=O)O
|
| ZINC1529332 ZINC | 0.500 | 206.1 Da LogP -2.21 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
O=C(O)C(=O)[C@H](C(=O)O)[C@H](O)C(=O)O
|
| ZINC1529333 ZINC | 0.500 | 206.1 Da LogP -2.21 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
O=C(O)C(=O)[C@@H](C(=O)O)[C@@H](O)C(=O)O
|
| ZINC1529334 ZINC | 0.500 | 206.1 Da LogP -2.21 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
O=C(O)C(=O)[C@@H](C(=O)O)[C@H](O)C(=O)O
|
| ZINC1724011 ZINC | 0.500 | 213.4 Da LogP 4.52 TPSA 12.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCNCCCCCCC
|
| ZINC225049737 ZINC | 0.500 | 243.4 Da LogP -1.11 TPSA 70.5 | ✓ Ro5 | ✓ Clean |
NCCCNCCN1CCN(CCCN)CC1
|
| ZINC4977317 ZINC | 0.500 | 228.4 Da LogP 3.33 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
CCCCNCCCCCCNCCCC
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.