Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 2.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Localization
- Localization
- CytoplasmicMembrane
Structure confidence
- ColabFold pLDDT
- 97.78 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MHFLNMFFFDIYPYIAGSVFLIGSWLRYDYGQYTWRAASSQMLDRKGMNLASNLFHIGILGIFAGHFLGMLTPHWMYESFLPIDVKQKMAMIAGGACGVMTLVGGLLLLKRRLLSPRVRATTTGADILILSLLMVQCALGLLTIPFSAQHMDGSEMMKLVGWAQSVVTFHGGASQHLDGVAFIFRVHLVLGMTLFLLFPFSRLVHIWSAPVEYLTRKYQIVRARR
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
9- GO:0009325 An enzyme complex that catalyzes the formation of nitrate from nitrite with the concomitant reduction of an acceptor.
- GO:0008940 Catalysis of the reaction: nitrite + acceptor = nitrate + reduced acceptor.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways.
- GO:0020037 Binding to a heme, a compound composed of iron complexed in a porphyrin (tetrapyrrole) ring.
- GO:0046872 Binding to a metal ion.
- GO:0160182 Catalysis of the reaction: a quinol + nitrate = a quinone + H2O + nitrite.
- GO:0019645 A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors other than oxygen to generate a transmembrane electrochemical gradient.
- GO:0042128 The nitrogen metabolic process that encompasses the uptake of nitrate from the environment and reduction to ammonia, and results in the incorporation of nitrogen derived from nitrate into cellular substances.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 110 | 128 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 89 | 109 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 27 | 46 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 89 | 108 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 149 | 178 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 199 | 225 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 179 | 198 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 216 | FunFam | G3DSA:1.20.950.20:FF:000001 | Respiratory nitrate reductase subunit gamma |
| 47 | 69 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 216 | Gene3D | G3DSA:1.20.950.20 | - |
| 1 | 225 | NCBIfam | TIGR00351 | respiratory nitrate reductase subunit gamma |
| 1 | 225 | InterPro | IPR003816 | Nitrate reductase, gamma subunit |
| 1 | 224 | SUPERFAMILY | SSF103501 | Respiratory nitrate reductase 1 gamma chain |
| 1 | 224 | InterPro | IPR036197 | NarG-like superfamily |
| 5 | 224 | Pfam | PF02665 | Nitrate reductase gamma subunit |
| 5 | 224 | InterPro | IPR023234 | NarG-like domain |
| 1 | 225 | PANTHER | PTHR30598 | NITRATE REDUCTASE PRIVATE CHAPERONE, REDOX ENZYME MATURATION PROTEIN REMP FAMILY |
| 1 | 5 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 184 | 206 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 129 | 148 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 47 | 69 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 127 | 149 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 4 | 26 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 6 | 26 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 70 | 88 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GZI7
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_04709
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 3PH RCSB PDB | P11350 | 705.0 Da LogP 12.07 TPSA 119.4 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O…
|
|
| 6MO RCSB PDB | P11350 | 95.9 Da LogP -0.00 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
[Mo+6]
|
|
| AGA RCSB PDB | P11350 | 455.5 Da LogP 1.85 TPSA 151.7 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)O[C@H](COC(=O)CCCC)COP(=O)([O-])OC[…
|
|
| F3S RCSB PDB | P11350 | 295.8 Da LogP 2.59 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
S1[Fe]2S[Fe]3[S]2[Fe]1S3
|
|
| MD1 RCSB PDB | P11350 | 740.6 Da LogP -2.13 TPSA 358.0 | 3 viol. | ✓ Clean |
c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…
|
|
| MGD RCSB PDB | P11350 | 740.6 Da LogP -2.06 TPSA 346.6 | 3 viol. | ✓ Clean |
c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@@](=…
|
|
| PCI RCSB PDB | P11350 | 266.3 Da LogP 4.66 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
c1(c(c(c(c(c1Cl)Cl)Cl)Cl)Cl)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1529471 ZINC | 1.000 | 266.3 Da LogP 4.66 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
Oc1c(Cl)c(Cl)c(Cl)c(Cl)c1Cl
|
| ZINC36178999 ZINC | 1.000 | 424.5 Da LogP 4.27 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](COP(=O)(O)O)OC(=O)CCCCCCC
|
| ZINC36179002 ZINC | 1.000 | 424.5 Da LogP 4.27 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O)CCCCCCC
|
| ZINC5820131 ZINC | 0.971 | 368.4 Da LogP 2.71 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](COP(=O)(O)O)OC(=O)CCCCC
|
| ZINC5820134 ZINC | 0.971 | 368.4 Da LogP 2.71 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O)CCCCC
|
| ZINC225408 ZINC | 0.900 | 247.9 Da LogP 3.71 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
Oc1c(Cl)c(Cl)c(O)c(Cl)c1Cl
|
| ZINC154748 ZINC | 0.818 | 247.9 Da LogP 3.71 TPSA 40.5 | ✓ Ro5 | Alert |
Oc1c(O)c(Cl)c(Cl)c(Cl)c1Cl
|
| ZINC102191119 ZINC | 0.792 | 498.6 Da LogP 3.65 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@@H](O)CO…
|
| ZINC58649551 ZINC | 0.792 | 498.6 Da LogP 3.65 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@H](O)CO)…
|
| ZINC4521879 ZINC | 0.743 | 386.5 Da LogP 4.73 TPSA 78.9 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OCC(COC(=O)CCCCC)OC(=O)CCCCC
|
| ZINC102190506 ZINC | 0.727 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OCCN)OC(=O)CC…
|
| ZINC102190512 ZINC | 0.727 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OCCN)OC(=O)C…
|
| ZINC27416437 ZINC | 0.705 | 411.4 Da LogP 2.69 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCCN)OC(=O)CCCCC
|
| ZINC33902364 ZINC | 0.705 | 411.4 Da LogP 2.69 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OCCN)OC(=O)CCC…
|
| ZINC137999083 ZINC | 0.700 | 424.5 Da LogP 4.87 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCCC(=O)OC[C@H](O)COP(=O)(O)O
|
| ZINC42851452 ZINC | 0.700 | 424.5 Da LogP 4.87 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)COP(=O)(O)O
|
| ZINC62624856 ZINC | 0.700 | 382.4 Da LogP 3.70 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@H](O)COP(=O)(O)O
|
| ZINC62624861 ZINC | 0.700 | 382.4 Da LogP 3.70 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@@H](O)COP(=O)(O)O
|
| ZINC8218993 ZINC | 0.700 | 410.5 Da LogP 4.48 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](O)COP(=O)(O)O
|
| ZINC8219000 ZINC | 0.700 | 410.5 Da LogP 4.48 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)COP(=O)(O)O
|
| ZINC13543394 ZINC | 0.689 | 455.4 Da LogP 2.15 TPSA 171.7 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@H](N)C(=O)…
|
| ZINC104869865 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(O…
|
| ZINC12504289 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC34541308 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC35000839 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC45284491 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC80639694 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC8215481 ZINC | 0.684 | 443.2 Da LogP -2.45 TPSA 252.6 | 2 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](CO[P@@](=O)(O)OP(=O)(…
|
| ZINC13544781 ZINC | 0.681 | 482.6 Da LogP 4.22 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)OC[C@@H](CO[P@](=O)(O)OCC[N+](C)(C)C…
|
| ZINC13544783 ZINC | 0.681 | 482.6 Da LogP 4.22 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCC[N+](C)(C)C)…
|
| ZINC13552119 ZINC | 0.675 | 270.2 Da LogP 0.58 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](O)COP(=O)(O)O
|
| ZINC36079847 ZINC | 0.667 | 344.5 Da LogP 4.15 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](CO)OC(=O)CCCCCCC
|
| ZINC4521911 ZINC | 0.667 | 344.4 Da LogP 3.56 TPSA 78.9 | ✓ Ro5 | ✓ Clean |
CCCCC(=O)OCC(COC(=O)CCCC)OC(=O)CCCC
|
| ZINC8214428 ZINC | 0.667 | 344.5 Da LogP 4.15 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO)OC(=O)CCCCCCC
|
| ZINC13543439 ZINC | 0.660 | 454.5 Da LogP 3.44 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](CO[P@](=O)(O)OCC[N+](C)(C)C)…
|
| ZINC13543441 ZINC | 0.660 | 454.5 Da LogP 3.44 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCC[N+](C)(C)C)O…
|
| ZINC103659671 ZINC | 0.641 | 358.5 Da LogP 3.95 TPSA 78.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)OC(COC(C)=O)COC(C)=O
|
| ZINC5820130 ZINC | 0.641 | 288.4 Da LogP 2.59 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](CO)OC(=O)CCCCC
|
| ZINC5820133 ZINC | 0.641 | 288.4 Da LogP 2.59 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO)OC(=O)CCCCC
|
| ZINC27646150 ZINC | 0.625 | 274.4 Da LogP 2.20 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO)OC(=O)CCCC
|
| ZINC102191158 ZINC | 0.620 | 456.5 Da LogP 3.08 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@@](=O)(O)OC[C@…
|
| ZINC14880758 ZINC | 0.620 | 484.6 Da LogP 3.86 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@](=O)(O)OC[…
|
| ZINC14880760 ZINC | 0.620 | 484.6 Da LogP 3.86 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@](=O)(O)OC[C…
|
| ZINC53683910 ZINC | 0.620 | 484.6 Da LogP 3.86 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@@](=O)(O)OC[…
|
| ZINC62592202 ZINC | 0.620 | 456.5 Da LogP 3.08 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@@](=O)(O)OC[C@…
|
| ZINC62592203 ZINC | 0.620 | 456.5 Da LogP 3.08 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OC[C…
|
| ZINC62592204 ZINC | 0.620 | 484.6 Da LogP 3.86 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OC…
|
| ZINC96094841 ZINC | 0.620 | 456.5 Da LogP 3.08 TPSA 142.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OC[C…
|
| ZINC3869963 ZINC | 0.610 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](COP(=O)(O)O)[C@@H](O)…
|
| ZINC3869965 ZINC | 0.610 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@@H](COP(=O)(O)O)[C@@H](O…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.