Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 2.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 48.237 Higher values support similarity to known essential genes.
- DEG E-value
- 0.0 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 94.84 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MTIITKKRLIAAGVLSALIAGNMAMAADVPAGVQLAEKQTLVRNSGAEPQSLDPNKIEGVPEANISRDLFEGLLNTSPKDGHPIPGVAESWDNKDFKVWTFHLRKDAKWSNGEPVTAQDFVYSWQRLVDPKTASPYASYPQYGHIVNVDEIIDGKKAPSELGVKAIDDHTLEVTLSEPVPYFYKLLVNPAMSPVYKPAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVMERNPHYWDNAKTVINTVTWLPTSSEVTYVNRYRSGELDMTYNQLPIELFQKLKKEIPNELHVDPYLCTYYYEINNQKAPFTDVRVRTALKLGLDRDIIANKVKGQGDLPAYGYTPPYTDGAKLSEPEWFTWSQEKRNEEAKKLLAEAGYSADKPLTFNLLYNTSDLHKKLAIAAASLWRKNLGIDVKLVNQEWKTFLDTRHQGTYDVARAGWCADYNEPTSFLNTMLSDSSMNTAHYKSPAFDKIMAESVKASDEAQRTAAYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPMDNVYTKDLYVIKH
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Periplasmic
Gene Ontology (GO)
6- GO:0043190 A complex for the transport of metabolites into and out of the cell, typically comprised of four domains; two membrane-associated domains and two ATP-binding domains at the intracellular face of the membrane, that form a central pore through the plasma membrane. Each of the four core domains may be encoded as a separate polypeptide or the domains can be fused in any one of a number of ways into multidomain polypeptides. In Bacteria and Archaebacteria, ABC transporters also include substrate binding proteins to bind substrate external to the cytoplasm and deliver it to the transporter.
- GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
- GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
- GO:1904680 Enables the transfer of a peptide from one side of a membrane to the other.
- GO:0015833 The directed movement of peptides, compounds of two or more amino acids where the alpha carboxyl group of one is bound to the alpha amino group of another, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
- GO:0015031 The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 9 | 20 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 187 | 305 | FunFam | G3DSA:3.40.190.10:FF:000018 | Oligopeptide ABC transporter, oligopeptide-binding protein |
| 71 | 195 | FunFam | G3DSA:3.90.76.10:FF:000001 | Oligopeptide ABC transporter substrate-binding protein |
| 35 | 526 | SUPERFAMILY | SSF53850 | Periplasmic binding protein-like II |
| 83 | 464 | Pfam | PF00496 | Bacterial extracellular solute-binding proteins, family 5 Middle |
| 83 | 464 | InterPro | IPR000914 | Solute-binding protein family 5 domain |
| 1 | 8 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 71 | 195 | Gene3D | G3DSA:3.90.76.10 | - |
| 1 | 26 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 298 | 513 | Gene3D | G3DSA:3.10.105.10 | - |
| 88 | 109 | ProSitePatterns | PS01040 | Bacterial extracellular solute-binding proteins, family 5 signature. |
| 88 | 109 | InterPro | IPR023765 | Solute-binding protein family 5, conserved site |
| 27 | 544 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 39 | 541 | CDD | cd08504 | PBP2_OppA |
| 1 | 26 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 298 | 514 | FunFam | G3DSA:3.10.105.10:FF:000001 | Oligopeptide ABC transporter, oligopeptide-binding protein |
| 41 | 525 | Gene3D | G3DSA:3.40.190.10 | - |
| 1 | 543 | PIRSF | PIRSF002741 | MppA |
| 1 | 543 | InterPro | IPR030678 | Peptide/nickel binding protein, MppA-type |
| 1 | 26 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 12 | 542 | PANTHER | PTHR30290 | PERIPLASMIC BINDING COMPONENT OF ABC TRANSPORTER |
| 12 | 542 | InterPro | IPR039424 | Solute-binding protein family 5 |
| 21 | 26 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GZH5
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_04696
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 6RP RCSB PDB | P33590 | 192.2 Da LogP 0.21 TPSA 72.9 | ✓ Ro5 | ✓ Clean |
c1cnn(c1)C(C(=O)O)n2cccn2
|
|
| 9YH RCSB PDB | P33590 | 448.5 Da LogP 2.60 TPSA 110.5 | ✓ Ro5 | Alert |
COc1cccc(c1O)CN(CCN(Cc2ccccc2SC)CC(=O)O)CC(=O)O
|
|
| 9YK RCSB PDB | P33590 | 434.5 Da LogP 2.29 TPSA 121.5 | ✓ Ro5 | Alert |
CSc1ccccc1CN(CCN(Cc2cccc(c2O)O)CC(=O)O)CC(=O)O
|
|
| BHN RCSB PDB | P33590 | 388.4 Da LogP 1.57 TPSA 121.5 | ✓ Ro5 | Alert |
c1ccc(c(c1)C[N@@](CC[N@](Cc2ccccc2O)CC(=O)O)CC(…
|
|
| BHR RCSB PDB | P33590 | 404.4 Da LogP 1.28 TPSA 141.8 | ✓ Ro5 | Alert |
c1ccc(c(c1)C[N@@](CC[N@](Cc2cccc(c2O)O)CC(=O)O)…
|
|
| BHZ RCSB PDB | P33590 | 372.4 Da LogP 1.87 TPSA 101.3 | ✓ Ro5 | Alert |
c1ccc(cc1)C[N@@](CC[N@](Cc2ccccc2O)CC(=O)O)CC(=…
|
|
| CMO RCSB PDB | P33590 | 28.0 Da LogP -0.04 TPSA 19.9 | ✓ Ro5 | ✓ Clean |
[C-]#[O+]
|
|
| DTD RCSB PDB | P33590 | 152.2 Da LogP 0.10 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
C1[C@@H]([C@H](CSS1)O)O
|
|
| DTT RCSB PDB | P33590 | 154.3 Da LogP -0.43 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
C([C@@H]([C@H](CS)O)O)S
|
|
| DTU RCSB PDB | P33590 | 154.3 Da LogP -0.43 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
C([C@H]([C@H](CS)O)O)S
|
|
| DTV RCSB PDB | P33590 | 154.3 Da LogP -0.43 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
C([C@H]([C@@H](CS)O)O)S
|
|
| EDT RCSB PDB | P33590 | 292.2 Da LogP -2.07 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
C(CN(CC(=O)O)CC(=O)O)N(CC(=O)O)CC(=O)O
|
|
| GDS RCSB PDB | B8F653 | 612.6 Da LogP -3.88 TPSA 317.6 | 3 viol. | ✓ Clean |
C(CC(=O)N[C@@H](CSSC[C@@H](C(=O)NCC(=O)O)NC(=O)…
|
|
| HCT RCSB PDB | P33590 | 190.2 Da LogP 0.03 TPSA 111.9 | ✓ Ro5 | ✓ Clean |
C(CC(=O)O)[C@H](CC(=O)O)C(=O)O
|
|
| IUM RCSB PDB | P06202 | 270.0 Da LogP -2.38 TPSA 46.1 | ✓ Ro5 | ✓ Clean |
[O-][U+4][O-]
|
|
| MHI RCSB PDB | P77348 | 390.4 Da LogP -2.17 TPSA 222.1 | 1 viol. | ✓ Clean |
C[C@@H](C(=O)N[C@H](CCC(=O)N[C@@H](CCC[C@H](C(=…
|
|
| MLI RCSB PDB | B8F653 | 102.0 Da LogP -3.12 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(=O)[O-]
|
|
| PER RCSB PDB | P33590 | 32.0 Da LogP -2.38 TPSA 46.1 | ✓ Ro5 | ✓ Clean |
[O-][O-]
|
|
| U1 RCSB PDB | P06202 | 238.0 Da LogP 0.00 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
[U]
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC19364242 ZINC | 1.000 | 292.2 Da LogP -2.07 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
O=C(O)CN(CCN(CC(=O)O)CC(=O)O)CC(=O)O
|
| ZINC19368612 ZINC | 1.000 | 388.4 Da LogP 1.57 TPSA 121.5 | ✓ Ro5 | Alert |
O=C(O)CN(CCN(CC(=O)O)Cc1ccccc1O)Cc1ccccc1O
|
| ZINC19419017 ZINC | 0.933 | 393.3 Da LogP -2.68 TPSA 196.2 | ✓ Ro5 | ✓ Clean |
O=C(O)CN(CCN(CC(=O)O)CC(=O)O)CCN(CC(=O)O)CC(=O)O
|
| ZINC22593216 ZINC | 0.933 | 494.5 Da LogP -3.30 TPSA 236.8 | 1 viol. | ✓ Clean |
O=C(O)CN(CCN(CCN(CC(=O)O)CC(=O)O)CC(=O)O)CCN(CC…
|
| ZINC4556980 ZINC | 0.825 | 321.4 Da LogP -1.77 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CSC[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC1769289 ZINC | 0.765 | 306.3 Da LogP -1.68 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
O=C(O)CN(CCCN(CC(=O)O)CC(=O)O)CC(=O)O
|
| ZINC4683946 ZINC | 0.765 | 320.3 Da LogP -1.29 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
O=C(O)CN(CCCCN(CC(=O)O)CC(=O)O)CC(=O)O
|
| ZINC1690029 ZINC | 0.750 | 204.2 Da LogP 0.42 TPSA 111.9 | ✓ Ro5 | ✓ Clean |
O=C(O)CCC(CCC(=O)O)C(=O)O
|
| ZINC22451417 ZINC | 0.750 | 416.5 Da LogP 2.05 TPSA 110.5 | ✓ Ro5 | Alert |
CCOC(=O)CN(CCN(CC(=O)O)Cc1ccccc1O)Cc1ccccc1O
|
| ZINC19364891 ZINC | 0.737 | 204.2 Da LogP -0.98 TPSA 81.1 | ✓ Ro5 | ✓ Clean |
CN(C)CCN(CC(=O)O)CC(=O)O
|
| ZINC19364892 ZINC | 0.737 | 232.3 Da LogP -0.20 TPSA 81.1 | ✓ Ro5 | ✓ Clean |
CCN(CC)CCN(CC(=O)O)CC(=O)O
|
| ZINC19366122 ZINC | 0.737 | 278.3 Da LogP -2.16 TPSA 138.6 | ✓ Ro5 | ✓ Clean |
O=C(O)CN(CCO)CCN(CC(=O)O)CC(=O)O
|
| ZINC33806192 ZINC | 0.737 | 320.3 Da LogP -1.29 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
O=C(O)CCN(CCC(=O)O)CCN(CC(=O)O)CC(=O)O
|
| ZINC5908834 ZINC | 0.737 | 379.3 Da LogP -2.09 TPSA 196.2 | ✓ Ro5 | ✓ Clean |
O=C(O)CN(CCN(CCN(CC(=O)O)CC(=O)O)C(=O)O)CC(=O)O
|
| ZINC2527900 ZINC | 0.722 | 205.2 Da LogP -1.07 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CCN(CC(=O)O)CC(=O)O
|
| ZINC4261886 ZINC | 0.722 | 348.4 Da LogP -0.51 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
O=C(O)CN(CCCCCCN(CC(=O)O)CC(=O)O)CC(=O)O
|
| ZINC149813449 ZINC | 0.700 | 278.2 Da LogP -1.48 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
O=C(O)CN(CCN(CC(=O)O)C(=O)O)CC(=O)O
|
| ZINC22576460 ZINC | 0.684 | 320.3 Da LogP -1.29 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
O=C(O)CCN(CCN(CCC(=O)O)CC(=O)O)CC(=O)O
|
| ZINC90669676 ZINC | 0.667 | 377.4 Da LogP -2.57 TPSA 176.0 | ✓ Ro5 | ✓ Clean |
O=CCN(CCN(CC(=O)O)CC(=O)O)CCN(CC(=O)O)CC(=O)O
|
| ZINC13514809 ZINC | 0.650 | 404.4 Da LogP -1.77 TPSA 222.1 | 1 viol. | ✓ Clean |
NCCCC[C@H](NC(=O)CC[C@H](NC(=O)CC[C@H](N)C(=O)O…
|
| ZINC22052182 ZINC | 0.650 | 336.3 Da LogP -2.05 TPSA 164.9 | ✓ Ro5 | ✓ Clean |
O=C(O)CN(CCOCCN(CC(=O)O)CC(=O)O)CC(=O)O
|
| ZINC2242980 ZINC | 0.649 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@H](N)C(=O)N[C@@H](CCC(=O)O)C(=O)O
|
| ZINC2560662 ZINC | 0.649 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@@H](N)C(=O)N[C@H](CCC(=O)O)C(=O)O
|
| ZINC13514803 ZINC | 0.641 | 347.3 Da LogP -1.88 TPSA 196.1 | 1 viol. | ✓ Clean |
C[C@H](NC(=O)CC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=…
|
| ZINC15261541 ZINC | 0.641 | 261.3 Da LogP -1.51 TPSA 155.7 | ✓ Ro5 | ✓ Clean |
NCCC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC217755395 ZINC | 0.636 | 263.2 Da LogP -1.47 TPSA 147.8 | ✓ Ro5 | ✓ Clean |
O=NN(CCN(CC(=O)O)CC(=O)O)CC(=O)O
|
| ZINC1575564 ZINC | 0.632 | 202.3 Da LogP 0.09 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCC[C@H](NC(=O)[C@@H](C)N)C(=O)O
|
| ZINC1575565 ZINC | 0.632 | 202.3 Da LogP 0.09 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCC[C@@H](NC(=O)[C@@H](C)N)C(=O)O
|
| ZINC1575566 ZINC | 0.632 | 202.3 Da LogP 0.09 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCC[C@H](NC(=O)[C@H](C)N)C(=O)O
|
| ZINC1575567 ZINC | 0.632 | 202.3 Da LogP 0.09 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CCCC[C@@H](NC(=O)[C@H](C)N)C(=O)O
|
| ZINC2242694 ZINC | 0.632 | 276.2 Da LogP -1.39 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC2504612 ZINC | 0.632 | 217.2 Da LogP -1.83 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)O
|
| ZINC2547582 ZINC | 0.632 | 276.2 Da LogP -1.39 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC2560934 ZINC | 0.632 | 217.2 Da LogP -1.83 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCC(N)=O)C(=O)O
|
| ZINC2560982 ZINC | 0.632 | 217.2 Da LogP -1.83 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
C[C@@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)O
|
| ZINC3204007 ZINC | 0.632 | 203.2 Da LogP -1.36 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
C[C@H](N)C(=O)N[C@@H](CCCN)C(=O)O
|
| ZINC4096970 ZINC | 0.632 | 405.4 Da LogP -2.04 TPSA 233.4 | 1 viol. | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CCC(=O)N[C@@H](CCC(=O)O)…
|
| ZINC4523272 ZINC | 0.632 | 217.2 Da LogP -1.83 TPSA 135.5 | ✓ Ro5 | ✓ Clean |
C[C@@H](N)C(=O)N[C@H](CCC(N)=O)C(=O)O
|
| ZINC4545890 ZINC | 0.632 | 276.2 Da LogP -1.39 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC4545891 ZINC | 0.632 | 276.2 Da LogP -1.39 TPSA 167.0 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@H](CCC(=O)O)C(=O)O)C(=O)O
|
| ZINC16887664 ZINC | 0.625 | 218.2 Da LogP 0.81 TPSA 111.9 | ✓ Ro5 | ✓ Clean |
O=C(O)CCC[C@@H](CCC(=O)O)C(=O)O
|
| ZINC16887665 ZINC | 0.625 | 218.2 Da LogP 0.81 TPSA 111.9 | ✓ Ro5 | ✓ Clean |
O=C(O)CCC[C@H](CCC(=O)O)C(=O)O
|
| ZINC3861663 ZINC | 0.619 | 380.4 Da LogP -2.04 TPSA 174.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CN(CCOCCOCCN(CC(=O)O)CC(=O)O)CC(=O)O
|
| ZINC15722130 ZINC | 0.617 | 488.5 Da LogP -2.61 TPSA 243.0 | 1 viol. | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@@H](CCCCN)C(=O)…
|
| ZINC255987061 ZINC | 0.617 | 488.5 Da LogP -2.61 TPSA 243.0 | 1 viol. | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@H](CCCCN)C(=O)N…
|
| ZINC255987062 ZINC | 0.617 | 488.5 Da LogP -2.61 TPSA 243.0 | 1 viol. | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@H](CCCCN)C(=O)N…
|
| ZINC255987063 ZINC | 0.617 | 488.5 Da LogP -2.61 TPSA 243.0 | 1 viol. | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@H](CCCCN)C(=O)N…
|
| ZINC255987064 ZINC | 0.617 | 488.5 Da LogP -2.61 TPSA 243.0 | 1 viol. | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@H](CCCCN)C(=O)N…
|
| ZINC3014479 ZINC | 0.615 | 217.3 Da LogP -0.97 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
C[C@@H](N)C(=O)N[C@@H](CCCCN)C(=O)O
|
| ZINC3014482 ZINC | 0.615 | 217.3 Da LogP -0.97 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
C[C@H](N)C(=O)N[C@H](CCCCN)C(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.