Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 0.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Localization
- Localization
- Unknown
Structure confidence
- ColabFold pLDDT
- 88.51 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MFSISPVFFWANIYVPADFEDYCVNTLKKTALLSVLALYIPVSQAAAKEYSLDPQHTSVVISWNHFGFSNPTAYISDVSGKLAFDKENPEKSSVNVTLPVKTIDAHVKALTDEFLGKEYFDVKTFPDATFQSTKVESKGDNKYDVEGNLTIKGITKPVVLHAVLNKQDMHPMVKKEAIGFDATGVIKRSDFKLDKYVPAVSDNVTITLSTEAYAK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
No GO or EC annotations are currently loaded for this protein.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 49 | 213 | SMART | SM00867 | YceI_2 |
| 49 | 213 | InterPro | IPR007372 | Lipid/polyisoprenoid-binding, YceI-like |
| 47 | 213 | SUPERFAMILY | SSF101874 | YceI-like |
| 47 | 213 | InterPro | IPR036761 | Lipid/polyisoprenoid-binding, YceI-like superfamily |
| 50 | 212 | Pfam | PF04264 | YceI-like domain |
| 50 | 212 | InterPro | IPR007372 | Lipid/polyisoprenoid-binding, YceI-like |
| 48 | 215 | Gene3D | G3DSA:2.40.128.110 | - |
| 48 | 215 | InterPro | IPR036761 | Lipid/polyisoprenoid-binding, YceI-like superfamily |
| 32 | 213 | PANTHER | PTHR34406 | PROTEIN YCEI |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GZH0
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_04687
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 8PP RCSB PDB | P0A8X2 | 639.1 Da LogP 14.99 TPSA 20.2 | 2 viol. | ✓ Clean |
CC(=CCCC(=CCC/C(=C/CC/C(=C/CCC(=CCC/C(=C/CCC(=C…
|
|
| 9UM RCSB PDB | Q0PB90 | 271.1 Da LogP 1.02 TPSA 43.0 | ✓ Ro5 | ✓ Clean |
CC1=C(N2C(=C(C(=O)N2C1=O)C)CBr)C
|
|
| LFA RCSB PDB | Q0PB90 | 282.6 Da LogP 8.05 TPSA 0.0 | 1 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCCCC
|
|
| MBO RCSB PDB | Q0PB90 | 321.7 Da LogP 0.56 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1C(=O)O)[Hg]
|
|
| MNB RCSB PDB | Q0PB90 | 199.2 Da LogP 1.58 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
c1cc(c(cc1S)C(=O)O)[N+](=O)[O-]
|
|
| OTP RCSB PDB | P83815 | 722.9 Da LogP 13.26 TPSA 113.3 | 2 viol. | ✓ Clean |
CC(=CCC/C(=C/CC/C(=C/CC/C(=C/CC/C(=C/CC/C(=C/CC…
|
|
| SEC RCSB PDB | Q0PB90 | 168.1 Da LogP -1.28 TPSA 63.3 | ✓ Ro5 | ✓ Clean |
C([C@@H](C(=O)O)N)[SeH]
|
|
| UQ8 RCSB PDB | Q9I690 | 727.1 Da LogP 14.40 TPSA 52.6 | 2 viol. | Alert |
CC1=C(C(=O)C(=C(C1=O)OC)OC)CC=C(C)CC\C=C(/C)\CC…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1532641 ZINC | 0.972 | 318.4 Da LogP 4.04 TPSA 52.6 | ✓ Ro5 | Alert |
COC1=C(OC)C(=O)C(C/C=C(\C)CCC=C(C)C)=C(C)C1=O
|
| ZINC1559692 ZINC | 0.730 | 250.3 Da LogP 2.32 TPSA 52.6 | ✓ Ro5 | Alert |
COC1=C(OC)C(=O)C(CC=C(C)C)=C(C)C1=O
|
| ZINC8215740 ZINC | 0.697 | 246.1 Da LogP 1.18 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CC(C)=CCO[P@@](=O)(O)OP(=O)(O)O
|
| ZINC1531959 ZINC | 0.676 | 246.3 Da LogP 4.33 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
CC(C)=CCC/C(C)=C/Cc1cc(O)ccc1O
|
| ZINC71769106 ZINC | 0.657 | 326.1 Da LogP 1.30 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
CC(C)=CCO[P@@](=O)(O)O[P@@](=O)(O)OP(=O)(O)O
|
| ZINC2575270 ZINC | 0.656 | 211.1 Da LogP 0.99 TPSA 117.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc([N+](=O)[O-])c(C(=O)O)c1
|
| ZINC4404106 ZINC | 0.656 | 212.1 Da LogP 1.20 TPSA 123.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc([N+](=O)[O-])ccc1[N+](=O)[O-]
|
| ZINC2565533 ZINC | 0.655 | 256.1 Da LogP 0.90 TPSA 160.9 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(C(=O)O)c([N+](=O)[O-])cc1[N+](=O)[O-]
|
| ZINC2553928 ZINC | 0.643 | 207.2 Da LogP -0.42 TPSA 69.0 | ✓ Ro5 | ✓ Clean |
Cc1c(C)n2c(CN)c(C)c(=O)n2c1=O
|
| ZINC8436838 ZINC | 0.639 | 262.1 Da LogP 0.15 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
C/C(=C\CO[P@@](=O)(O)OP(=O)(O)O)CO
|
| ZINC1689765 ZINC | 0.636 | 201.6 Da LogP 1.95 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(Cl)ccc1[N+](=O)[O-]
|
| ZINC1692553 ZINC | 0.636 | 246.0 Da LogP 2.06 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(Br)ccc1[N+](=O)[O-]
|
| ZINC34143793 ZINC | 0.636 | 293.0 Da LogP 1.90 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(I)ccc1[N+](=O)[O-]
|
| ZINC114185151 ZINC | 0.632 | 298.2 Da LogP 2.15 TPSA 108.7 | ✓ Ro5 | Alert |
O=C(O)c1ccc(C(=O)C(=O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC13539354 ZINC | 0.615 | 332.2 Da LogP 3.20 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CC(C)=CCC/C(C)=C(\F)CO[P@](=O)(O)OP(=O)(O)O
|
| ZINC1545440 ZINC | 0.615 | 213.4 Da LogP 4.65 TPSA 26.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCN
|
| ZINC1644076 ZINC | 0.615 | 214.4 Da LogP 4.68 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCO
|
| ZINC1680803 ZINC | 0.615 | 200.4 Da LogP 4.29 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCO
|
| ZINC195766643 ZINC | 0.615 | 231.9 Da LogP 2.93 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[Sn+3]
|
| ZINC59144932 ZINC | 0.615 | 202.4 Da LogP 4.84 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCS
|
| ZINC134079 ZINC | 0.600 | 242.2 Da LogP 2.75 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(C(=O)O)cc2)cc1
|
| ZINC1640789 ZINC | 0.600 | 374.3 Da LogP 3.55 TPSA 108.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)c2ccc(C(=O)c3ccc(C(=O)O)cc3)cc…
|
| ZINC19801481 ZINC | 0.600 | 223.2 Da LogP 2.59 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
CC(C)(C)c1ccc([N+](=O)[O-])c(C(=O)O)c1
|
| ZINC2146859 ZINC | 0.600 | 270.2 Da LogP 2.31 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(C(=O)c2ccc(C(=O)O)cc2)cc1
|
| ZINC3147211 ZINC | 0.600 | 318.3 Da LogP 4.42 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(-c3ccc(C(=O)O)cc3)cc2)cc1
|
| ZINC188555 ZINC | 0.591 | 350.3 Da LogP 4.67 TPSA 93.1 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Oc2ccc(Oc3ccc(C(=O)O)cc3)cc2)cc1
|
| ZINC241160 ZINC | 0.591 | 258.2 Da LogP 2.88 TPSA 83.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Oc2ccc(C(=O)O)cc2)cc1
|
| ZINC1870293 ZINC | 0.583 | 247.1 Da LogP 0.10 TPSA 138.0 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(P(=O)(O)O)ccc1[N+](=O)[O-]
|
| ZINC197020550 ZINC | 0.583 | 246.2 Da LogP -0.06 TPSA 140.6 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)c1ccc([N+](=O)[O-])c(C(=O)O)c1
|
| ZINC19845324 ZINC | 0.583 | 210.2 Da LogP 1.36 TPSA 83.7 | ✓ Ro5 | ✓ Clean |
CN(C)c1ccc([N+](=O)[O-])c(C(=O)O)c1
|
| ZINC59269089 ZINC | 0.583 | 245.2 Da LogP 0.70 TPSA 114.6 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc([N+](=O)[O-])c(C(=O)O)c1
|
| ZINC72338575 ZINC | 0.583 | 235.1 Da LogP 2.31 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(C(F)(F)F)ccc1[N+](=O)[O-]
|
| ZINC7814925 ZINC | 0.583 | 213.2 Da LogP 2.01 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
CSc1ccc([N+](=O)[O-])c(C(=O)O)c1
|
| ZINC3845121 ZINC | 0.576 | 226.1 Da LogP 0.57 TPSA 143.8 | ✓ Ro5 | ✓ Clean |
Nc1cc([N+](=O)[O-])c(C(=O)O)cc1C(=O)O
|
| ZINC100027350 ZINC | 0.571 | 227.4 Da LogP 4.91 TPSA 12.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCNCCCCCCC
|
| ZINC1627284 ZINC | 0.571 | 214.4 Da LogP 4.94 TPSA 9.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCOCCCCCCC
|
| ZINC1699899 ZINC | 0.571 | 202.4 Da LogP 4.88 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
CCCCCCSCCCCCC
|
| ZINC1724011 ZINC | 0.571 | 213.4 Da LogP 4.52 TPSA 12.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCNCCCCCCC
|
| ZINC2564179 ZINC | 0.571 | 214.4 Da LogP 4.94 TPSA 9.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCOCCCCCC
|
| ZINC4284655 ZINC | 0.568 | 224.2 Da LogP 1.25 TPSA 109.5 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1ccc([N+](=O)[O-])c(C(=O)O)c1
|
| ZINC389804 ZINC | 0.565 | 214.2 Da LogP 2.76 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(-c2ccc(O)cc2)cc1
|
| ZINC392302 ZINC | 0.560 | 230.2 Da LogP 2.88 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Oc2ccc(O)cc2)cc1
|
| ZINC346060 ZINC | 0.559 | 245.6 Da LogP 1.64 TPSA 117.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(C(=O)O)c([N+](=O)[O-])cc1Cl
|
| ZINC14985550 ZINC | 0.553 | 225.2 Da LogP 1.08 TPSA 106.7 | ✓ Ro5 | ✓ Clean |
COC(=O)c1ccc([N+](=O)[O-])c(C(=O)O)c1
|
| ZINC15443713 ZINC | 0.553 | 236.2 Da LogP 1.89 TPSA 83.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(N2CCCC2)ccc1[N+](=O)[O-]
|
| ZINC1610707 ZINC | 0.553 | 269.3 Da LogP 3.46 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(/C=C/c2ccccc2)ccc1[N+](=O)[O-]
|
| ZINC19400583 ZINC | 0.553 | 225.2 Da LogP 2.08 TPSA 89.7 | ✓ Ro5 | ✓ Clean |
CC(C)Oc1ccc([N+](=O)[O-])c(C(=O)O)c1
|
| ZINC22163863 ZINC | 0.553 | 259.2 Da LogP 3.09 TPSA 89.7 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(Oc2ccccc2)ccc1[N+](=O)[O-]
|
| ZINC5160214 ZINC | 0.553 | 269.3 Da LogP 3.46 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1cc(/C=C\c2ccccc2)ccc1[N+](=O)[O-]
|
| ZINC388063 ZINC | 0.545 | 201.0 Da LogP 2.15 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Br)cc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.