KpKP13 Protein target profile

HTH-type transcriptional regulator czcR

Accession: KP13_04602

Gene: AHE44138.1 czcR 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GU22
Length 305
Pocket druggability (P2Rank · AlphaFold DB model) 0.104
Direct ligand evidence 0 56 total records
Functional annotation 0 EC 3 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
89.37 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.104
Structure A0A0H3GU22
Pocket Pocket 1
Druggability (FPocket) 0.573
Structure A0A0H3GU22
Pocket Pocket 1
ColabFold model
P2Rank 0.033 · Pocket 1
FPocket 0.599 · Pocket 8
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 11 / 4744 genomes with a hit
Prevalence 0.2%

Sequence

Primary amino-acid sequence viewer.

MQISHKVPMRIDDIDALLATVQFSSLNQAAEYLGITQSAITRRLQRLEQELNVTLLERQTRPLTLTAAGHRVYEQCLSIKRETKKLYSLLDPQGEPRGALRLGVPQSLSEIALPAALSALSQQFPGLSPQITCGWSGQLQRRLENGELDGMLAMGPAQQSFAEGYSGRLLCPLEVVPIVGRRLNLRASSLRECAERGWILNPDGCGLRAGLIRELQSQGLRLTLNVESAGAQLQIALVAQGLGLGLVPRAALASSPWRDEVAVLSLSDFQPAVSLWLIHAQYLANLQPPLTFFASKVVQQLTVSD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

3
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

22 records
Show feature table
Start End DB Term Name
94 279 Pfam PF03466 LysR substrate binding domain
94 279 InterPro IPR005119 LysR, substrate-binding
4 89 Gene3D G3DSA:1.10.10.10 -
4 89 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
98 280 Gene3D G3DSA:3.40.190.10 -
9 292 PANTHER PTHR30126 HTH-TYPE TRANSCRIPTIONAL REGULATOR
9 92 FunFam G3DSA:1.10.10.10:FF:000001 LysR family transcriptional regulator
95 282 SUPERFAMILY SSF53850 Periplasmic binding protein-like II
100 279 CDD cd05466 PBP2_LTTR_substrate
4 117 SUPERFAMILY SSF46785 Winged helix DNA-binding domain
4 117 InterPro IPR036390 Winged helix DNA-binding domain superfamily
12 69 Pfam PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
12 69 InterPro IPR000847 Transcription regulator HTH, LysR
9 66 ProSiteProfiles PS50931 LysR-type HTH domain profile.
9 66 InterPro IPR000847 Transcription regulator HTH, LysR
37 47 PRINTS PR00039 LysR bacterial regulatory protein HTH signature
37 47 InterPro IPR000847 Transcription regulator HTH, LysR
47 58 PRINTS PR00039 LysR bacterial regulatory protein HTH signature
47 58 InterPro IPR000847 Transcription regulator HTH, LysR
26 37 PRINTS PR00039 LysR bacterial regulatory protein HTH signature
26 37 InterPro IPR000847 Transcription regulator HTH, LysR
174 274 Gene3D G3DSA:3.40.190.10 -

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.104
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.573 Unusual size
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GU22
AlphaFold DB full sequence Viewing
ColabFold KP13_04602
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

56 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 6 records from similar proteins
Structural ligands 6 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
AKG PDB via homolog 146.1 Da · LogP -0.50 · TPSA 91.7 Open detail RCSB PDB
BEZ PDB via homolog Detail RCSB PDB
CCU PDB via homolog Detail RCSB PDB
FLC PDB via homolog Detail RCSB PDB
MLI PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
AKG RCSB PDB P73862 146.1 Da LogP -0.50 TPSA 91.7 ✓ Ro5 ✓ Clean C(CC(=O)O)C(=O)C(=O)O
BEZ RCSB PDB O68014 122.1 Da LogP 1.38 TPSA 37.3 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)O
CCU RCSB PDB P07774 142.1 Da LogP 0.27 TPSA 74.6 ✓ Ro5 ✓ Clean C(=C/C(=O)O)/C=C\C(=O)O
FLC RCSB PDB A0A0D1IHL7 189.1 Da LogP -5.25 TPSA 140.6 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
MLI RCSB PDB O68014 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
RUB RCSB PDB Q9F1R2 310.1 Da LogP -2.50 TPSA 191.0 1 viol. ✓ Clean C([C@H]([C@H](C(=O)COP(=O)(O)O)O)O)OP(=O)(O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.