KpKP13 Protein target profile
Putative iron compound ABC transport system periplasmic binding component
Accession: KP13_05333
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 0.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 92.24 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MRWFVSLLLLLTGAVSAAAPQTQTFTDDLGRTVTVPLHPQRIVSMHDLDITIPLIELGAPPIASHGRTRPDGSHYLRSSAQLTGVDFDNSDIRFIGTADIDLEAVAAARPDLIITEPSRHVSVEQLEKIAPTVSIDHLQGSAPEIYRKLAQLTGTQPRLAILERRYQEQIKQLKAMVNPPQYSVSVIQANNGKVTVHHSYHALGRVLRDAGFRFPPLIERIPDGQRIDVSAEQLPELDADFVFATWRSDTGGKPQDELQAMEGVMPGWCDFMRACRTGHYILLPREEVISNSYAALSLMVAQVQSHIAGRPIPAEAK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Gene Ontology (GO)
2- GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
- GO:1901678 The directed movement of an iron coordination entity into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 4 | 12 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 1 | 3 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 13 | 17 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 8 | 258 | PANTHER | PTHR30532 | IRON III DICITRATE-BINDING PERIPLASMIC PROTEIN |
| 1 | 17 | SignalP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM |
| 136 | 316 | Gene3D | G3DSA:3.40.50.1980 | Nitrogenase molybdenum iron protein domain |
| 17 | 297 | SUPERFAMILY | SSF53807 | Helical backbone metal receptor |
| 42 | 311 | ProSiteProfiles | PS50983 | Iron siderophore/cobalamin periplasmic-binding domain profile. |
| 42 | 311 | InterPro | IPR002491 | ABC transporter periplasmic binding domain |
| 21 | 135 | Gene3D | G3DSA:3.40.50.1980 | Nitrogenase molybdenum iron protein domain |
| 97 | 261 | Pfam | PF01497 | Periplasmic binding protein |
| 97 | 261 | InterPro | IPR002491 | ABC transporter periplasmic binding domain |
| 1 | 17 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 18 | 317 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 17 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GUR6
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_05333
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| EB4 RCSB PDB | P0AEL6 | 669.6 Da LogP -0.74 TPSA 287.6 | 3 viol. | Alert |
c1cc(c(c(c1)O)O)C(=O)N[C@H]2COC(=O)[C@H](COC(=O…
|
|
| ECA RCSB PDB | P40409 | 573.6 Da LogP 2.71 TPSA 208.7 | 2 viol. | Alert |
c1cc(c(c(c1)O)O)C(=O)NCc2cc(cc(c2)CNC(=O)c3cccc…
|
|
| VBN RCSB PDB | Q9RCF6 | 705.7 Da LogP 1.84 TPSA 243.1 | 3 viol. | Alert |
C[C@@H]1[C@H](N=C(O1)c2cccc(c2O)O)C(=O)NCCCN(CC…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC2383349849 ZINC | 0.647 | 259.3 Da LogP 1.73 TPSA 89.8 | ✓ Ro5 | Alert |
O=C(NCc1ccccc1)c1ccc(O)c(O)c1O
|
| ZINC3202026 ZINC | 0.606 | 227.3 Da LogP 2.32 TPSA 49.3 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccccc1)c1ccccc1O
|
| ZINC993877 ZINC | 0.600 | 413.3 Da LogP 4.85 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C(NCc1cccc(CNC(=O)c2ccccc2Cl)c1)c1ccccc1Cl
|
| ZINC192979762 ZINC | 0.591 | 323.4 Da LogP 2.27 TPSA 87.4 | ✓ Ro5 | Alert |
O=C(NCc1cccc(Cn2ccnc2)c1)c1cccc(O)c1O
|
| ZINC1164932 ZINC | 0.583 | 372.5 Da LogP 4.16 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
Cc1ccccc1C(=O)NCc1cccc(CNC(=O)c2ccccc2C)c1
|
| ZINC6251758 ZINC | 0.583 | 380.4 Da LogP 3.82 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C(NCc1cccc(CNC(=O)c2ccccc2F)c1)c1ccccc1F
|
| ZINC193135116 ZINC | 0.581 | 283.3 Da LogP 1.68 TPSA 86.9 | ✓ Ro5 | Alert |
O=C(NCc1ccn2ccnc2c1)c1cccc(O)c1O
|
| ZINC28305 ZINC | 0.563 | 344.4 Da LogP 3.55 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccccc1)c1ccccc1C(=O)NCc1ccccc1
|
| ZINC192933303 ZINC | 0.561 | 294.3 Da LogP 2.58 TPSA 82.5 | ✓ Ro5 | Alert |
O=C(NCc1nccc2ccccc12)c1cccc(O)c1O
|
| ZINC3937611 ZINC | 0.559 | 380.4 Da LogP 3.01 TPSA 139.1 | 1 viol. | Alert |
O=C(Nc1cccc(NC(=O)c2cccc(O)c2O)c1)c1cccc(O)c1O
|
| ZINC1772656721 ZINC | 0.558 | 233.2 Da LogP 0.60 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
C=C1C(=O)OC[C@H]1NC(=O)c1ccccc1O
|
| ZINC1689462 ZINC | 0.541 | 277.3 Da LogP 3.48 TPSA 49.3 | ✓ Ro5 | Alert |
O=C(NCc1ccccc1O)c1cccc2ccccc12
|
| ZINC20023716 ZINC | 0.541 | 228.3 Da LogP 1.72 TPSA 62.2 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccncc1)c1ccccc1O
|
| ZINC7345745 ZINC | 0.541 | 245.3 Da LogP 2.46 TPSA 49.3 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccc(F)cc1)c1ccccc1O
|
| ZINC5557697 ZINC | 0.538 | 241.3 Da LogP 2.63 TPSA 49.3 | ✓ Ro5 | ✓ Clean |
Cc1ccc(C(=O)NCc2ccccc2)c(O)c1
|
| ZINC25422677 ZINC | 0.537 | 257.3 Da LogP 2.33 TPSA 58.6 | ✓ Ro5 | ✓ Clean |
COc1cccc(CNC(=O)c2ccccc2O)c1
|
| ZINC49992341 ZINC | 0.535 | 334.4 Da LogP 1.37 TPSA 95.5 | ✓ Ro5 | ✓ Clean |
CNS(=O)(=O)Cc1cccc(CNC(=O)c2ccccc2O)c1
|
| ZINC69352214 ZINC | 0.535 | 323.3 Da LogP 2.62 TPSA 67.8 | ✓ Ro5 | ✓ Clean |
COc1cc(CNC(=O)c2cccc(F)c2F)cc(OC)c1O
|
| ZINC78739079 ZINC | 0.535 | 331.4 Da LogP 2.66 TPSA 77.0 | ✓ Ro5 | ✓ Clean |
COc1cc(CNC(=O)c2cccc(C)c2O)cc(OC)c1OC
|
| ZINC365757940 ZINC | 0.532 | 323.4 Da LogP 2.43 TPSA 87.4 | ✓ Ro5 | Alert |
Cn1ccnc1-c1cccc(CNC(=O)c2cccc(O)c2O)c1
|
| ZINC28394 ZINC | 0.528 | 261.3 Da LogP 3.77 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccccc1)c1cccc2ccccc12
|
| ZINC224745008 ZINC | 0.526 | 243.3 Da LogP 2.03 TPSA 69.6 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccccc1)c1cc(O)ccc1O
|
| ZINC3346496 ZINC | 0.526 | 277.3 Da LogP 3.48 TPSA 49.3 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccccc1)c1cc2ccccc2cc1O
|
| ZINC72331769 ZINC | 0.526 | 265.2 Da LogP 3.03 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
O=C(NCc1cc(F)cc(F)c1)c1ccccc1F
|
| ZINC2748404 ZINC | 0.525 | 434.4 Da LogP 3.36 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C(NCc1cccc(CNC(=O)c2ccccc2[N+](=O)[O-])c1)c1c…
|
| ZINC65553781 ZINC | 0.525 | 307.1 Da LogP 2.48 TPSA 62.2 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccncc1)c1cccc(Br)c1O
|
| ZINC9530774 ZINC | 0.525 | 257.3 Da LogP 2.33 TPSA 58.6 | ✓ Ro5 | ✓ Clean |
COc1cccc(C(=O)NCc2ccccc2)c1O
|
| ZINC193103082 ZINC | 0.523 | 286.3 Da LogP 2.04 TPSA 93.4 | ✓ Ro5 | Alert |
N#Cc1ccc(F)c(CNC(=O)c2cccc(O)c2O)c1
|
| ZINC2473029 ZINC | 0.514 | 255.3 Da LogP 2.31 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccccc1C(=O)NCc1ccccc1
|
| ZINC5601462 ZINC | 0.514 | 344.4 Da LogP 3.55 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C(NCc1cccc(CNC(=O)c2ccccc2)c1)c1ccccc1
|
| ZINC59031766 ZINC | 0.514 | 245.2 Da LogP 2.06 TPSA 89.8 | ✓ Ro5 | Alert |
O=C(Nc1ccccc1O)c1cccc(O)c1O
|
| ZINC1114209 ZINC | 0.513 | 352.4 Da LogP 3.35 TPSA 84.5 | ✓ Ro5 | ✓ Clean |
Cc1occc1C(=O)NCc1cccc(CNC(=O)c2ccoc2C)c1
|
| ZINC5679315 ZINC | 0.513 | 280.2 Da LogP 3.92 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
O=C(NCc1cccc(Cl)c1)c1ccccc1Cl
|
| ZINC72331437 ZINC | 0.513 | 281.7 Da LogP 3.55 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
O=C(NCc1cc(F)cc(F)c1)c1ccccc1Cl
|
| ZINC999458 ZINC | 0.512 | 432.5 Da LogP 4.34 TPSA 76.7 | ✓ Ro5 | ✓ Clean |
CCOc1ccccc1C(=O)NCc1cccc(CNC(=O)c2ccccc2OCC)c1
|
| ZINC32914502 ZINC | 0.511 | 356.4 Da LogP 2.12 TPSA 109.5 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)c1cccc(CNC(=O)c2ccc3ccccc3c2O)c1
|
| ZINC95350477 ZINC | 0.511 | 329.4 Da LogP 3.34 TPSA 78.8 | ✓ Ro5 | ✓ Clean |
CC(C)(C)OCc1cccc(CNC(=O)c2ccc(O)cc2O)c1
|
| ZINC1114529 ZINC | 0.500 | 372.5 Da LogP 4.16 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
Cc1ccccc1C(=O)NCc1ccc(CNC(=O)c2ccccc2C)cc1
|
| ZINC12623699 ZINC | 0.500 | 295.3 Da LogP 3.34 TPSA 49.3 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccc(C(F)(F)F)cc1)c1ccccc1O
|
| ZINC12735689 ZINC | 0.500 | 284.3 Da LogP 2.28 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1ccc(CNC(=O)c2ccccc2O)cc1
|
| ZINC1643009 ZINC | 0.500 | 259.3 Da LogP 1.73 TPSA 89.8 | ✓ Ro5 | Alert |
O=C(NCc1ccc(O)cc1O)c1ccccc1O
|
| ZINC1689025 ZINC | 0.500 | 261.7 Da LogP 2.98 TPSA 49.3 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccccc1)c1cc(Cl)ccc1O
|
| ZINC23055261 ZINC | 0.500 | 259.3 Da LogP 2.77 TPSA 49.3 | ✓ Ro5 | ✓ Clean |
Cc1ccc(CNC(=O)c2ccccc2O)cc1F
|
| ZINC2757038 ZINC | 0.500 | 380.4 Da LogP 3.82 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccc(CNC(=O)c2ccccc2F)cc1)c1ccccc1F
|
| ZINC299515 ZINC | 0.500 | 324.3 Da LogP 2.73 TPSA 84.5 | ✓ Ro5 | ✓ Clean |
O=C(NCc1cccc(CNC(=O)c2ccco2)c1)c1ccco1
|
| ZINC656080 ZINC | 0.500 | 380.4 Da LogP 3.82 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccc(F)cc1)c1ccccc1C(=O)NCc1ccc(F)cc1
|
| ZINC671357 ZINC | 0.500 | 380.4 Da LogP 3.82 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C(NCc1cccc(CNC(=O)c2cccc(F)c2)c1)c1cccc(F)c1
|
| ZINC671471 ZINC | 0.500 | 413.3 Da LogP 4.85 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccc(Cl)cc1)c1ccccc1C(=O)NCc1ccc(Cl)cc1
|
| ZINC8987610 ZINC | 0.500 | 271.3 Da LogP 2.64 TPSA 58.6 | ✓ Ro5 | ✓ Clean |
COc1cccc(C(=O)NCc2ccc(C)cc2)c1O
|
| ZINC9322571 ZINC | 0.500 | 270.3 Da LogP 2.39 TPSA 52.6 | ✓ Ro5 | Alert |
CN(C)c1ccc(CNC(=O)c2ccccc2O)cc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.