Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 0.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 95.81 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSVLFPPRLAPGDVIGVTAPSSGVPEHLHPRLELAIKNLKKRGYQVREGRCLRSQHKNKSATKFSRVEELMSYLTDPDIKAVMPRWGGDLAMELLDLIDFDLLSRSKPKWFVGFSDLSTLHFPLTTISGWATLHGPNLMDLGAQKLDATTQAVWEILESNRGTVIKQYSSTAFQADENQWGTASDGGFNLTQKTQWKRLDGVTSSLTFSGKLIGGCLEIISRLAGTPFGNVPLFKASNSPQGIILYFENVEMAPCELTRALFSLRLQGWFDNLNGVLIGRSAAPDVSDPTKHNYLDALKAAFENIAVPVLYDVDIGHIPPQISLVNGADATVFFAENGSWVTQQL
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Gene Ontology (GO)
3- GO:0004180 Catalysis of the hydrolysis of a single C-terminal amino acid residue from a polypeptide chain.
- GO:0008236 Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
- GO:0006508 The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 15 | 135 | Pfam | PF02016 | LD-carboxypeptidase N-terminal domain |
| 15 | 135 | InterPro | IPR040449 | LD-carboxypeptidase, N-terminal |
| 1 | 337 | PANTHER | PTHR30237 | MURAMOYLTETRAPEPTIDE CARBOXYPEPTIDASE |
| 1 | 337 | InterPro | IPR003507 | Peptidase family S66 |
| 2 | 168 | SUPERFAMILY | SSF52317 | Class I glutamine amidotransferase-like |
| 2 | 168 | InterPro | IPR029062 | Class I glutamine amidotransferase-like |
| 13 | 332 | CDD | cd07062 | Peptidase_S66_mccF_like |
| 166 | 344 | Gene3D | G3DSA:3.50.30.60 | - |
| 166 | 344 | InterPro | IPR027461 | LD-carboxypeptidase A, C-terminal domain superfamily |
| 2 | 160 | Gene3D | G3DSA:3.40.50.10740 | - |
| 2 | 160 | InterPro | IPR027478 | Murein tetrapeptide carboxypeptidase, N-terminal |
| 205 | 334 | SUPERFAMILY | SSF141986 | LD-carboxypeptidase A C-terminal domain-like |
| 205 | 334 | InterPro | IPR027461 | LD-carboxypeptidase A, C-terminal domain superfamily |
| 3 | 345 | PIRSF | PIRSF028757 | LD-carboxypeptidase |
| 3 | 345 | InterPro | IPR003507 | Peptidase family S66 |
| 209 | 332 | Pfam | PF17676 | LD-carboxypeptidase C-terminal domain |
| 209 | 332 | InterPro | IPR040921 | LD-carboxypeptidase, C-terminal |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GTZ2
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_05059
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 1EG RCSB PDB | Q47511 | 491.4 Da LogP -4.11 TPSA 275.1 | 2 viol. | ✓ Clean |
c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)COS(=O)(=…
|
|
| 1EI RCSB PDB | Q47511 | 476.4 Da LogP -3.69 TPSA 249.0 | 2 viol. | ✓ Clean |
c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)COS(=O)(=…
|
|
| 7MD RCSB PDB | Q47511 | 518.4 Da LogP -2.56 TPSA 273.3 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| A5A RCSB PDB | A0A6L8PEJ7 | 417.4 Da LogP -3.25 TPSA 217.8 | 1 viol. | ✓ Clean |
C[C@@H](C(=O)NS(=O)(=O)OC[C@@H]1[C@H]([C@H]([C@…
|
|
| DSZ RCSB PDB | A0A6L8PEJ7 | 461.4 Da LogP -3.79 TPSA 255.1 | 2 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| GSU RCSB PDB | Q47511 | 475.4 Da LogP -3.40 TPSA 255.1 | 2 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| LMS RCSB PDB | Q8Y6P6 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| SBT RCSB PDB | Q734X3 | 74.1 Da LogP 0.78 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CC[C@H](C)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC12405780 ZINC | 1.000 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@@H]…
|
| ZINC12501520 ZINC | 1.000 | 458.5 Da LogP -0.88 TPSA 123.5 | 1 viol. | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC12502832 ZINC | 1.000 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@@H]…
|
| ZINC3874716 ZINC | 1.000 | 414.5 Da LogP -0.90 TPSA 114.3 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC4283769 ZINC | 1.000 | 238.3 Da LogP -0.96 TPSA 77.4 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCO
|
| ZINC4521548 ZINC | 1.000 | 282.3 Da LogP -0.95 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCO
|
| ZINC5178829 ZINC | 1.000 | 326.4 Da LogP -0.93 TPSA 95.8 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5178830 ZINC | 1.000 | 370.4 Da LogP -0.91 TPSA 105.1 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC79460727 ZINC | 1.000 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@H](…
|
| ZINC79460732 ZINC | 1.000 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@H](…
|
| ZINC1083817667 ZINC | 0.841 | 459.5 Da LogP -2.22 TPSA 217.8 | 1 viol. | ✓ Clean |
CC(C)C[C@@H](N)C(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n…
|
| ZINC14967098 ZINC | 0.737 | 403.4 Da LogP -3.64 TPSA 217.8 | 1 viol. | ✓ Clean |
NCC(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc…
|
| ZINC1574270 ZINC | 0.737 | 421.4 Da LogP -0.26 TPSA 162.7 | 1 viol. | ✓ Clean |
Cc1ccc(S(=O)(=O)OC[C@@H]2O[C@H](n3cnc4c(N)ncnc4…
|
| ZINC218033334 ZINC | 0.737 | 403.4 Da LogP -3.64 TPSA 217.8 | 1 viol. | ✓ Clean |
NCC(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc…
|
| ZINC218033425 ZINC | 0.737 | 403.4 Da LogP -3.64 TPSA 217.8 | 1 viol. | ✓ Clean |
NCC(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc…
|
| ZINC218033503 ZINC | 0.737 | 403.4 Da LogP -3.64 TPSA 217.8 | 1 viol. | ✓ Clean |
NCC(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc…
|
| ZINC3861767 ZINC | 0.737 | 421.4 Da LogP -0.26 TPSA 162.7 | 1 viol. | ✓ Clean |
Cc1ccc(S(=O)(=O)OC[C@H]2O[C@@H](n3cnc4c(N)ncnc4…
|
| ZINC13547650 ZINC | 0.731 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@H](O)…
|
| ZINC4823971 ZINC | 0.731 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](O…
|
| ZINC4823975 ZINC | 0.731 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](…
|
| ZINC4823980 ZINC | 0.731 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](O…
|
| ZINC4823984 ZINC | 0.731 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](…
|
| ZINC5011204 ZINC | 0.731 | 295.3 Da LogP -1.80 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COC=O)[C@@H](O)[C@H…
|
| ZINC5011205 ZINC | 0.731 | 295.3 Da LogP -1.80 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COC=O)[C@@H](O)[C@…
|
| ZINC5011206 ZINC | 0.731 | 295.3 Da LogP -1.80 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COC=O)[C@@H](O)[C@@…
|
| ZINC5011208 ZINC | 0.731 | 295.3 Da LogP -1.80 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COC=O)[C@@H](O)[C@…
|
| ZINC24951137 ZINC | 0.724 | 417.4 Da LogP -2.41 TPSA 221.3 | 1 viol. | ✓ Clean |
C[C@H](N)/C(O)=N/S(=O)(=O)OC[C@H]1O[C@@H](n2cnc…
|
| ZINC31413936 ZINC | 0.722 | 380.8 Da LogP -2.10 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1nc(Cl)nc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C…
|
| ZINC105372833 ZINC | 0.717 | 345.3 Da LogP -1.93 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(N)(N)=O)[C@H](O…
|
| ZINC105372837 ZINC | 0.717 | 345.3 Da LogP -1.93 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(N)(N)=O)[C@H](O…
|
| ZINC13518964 ZINC | 0.717 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@H](…
|
| ZINC1532515 ZINC | 0.717 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@H](O…
|
| ZINC1571045 ZINC | 0.717 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC17107643 ZINC | 0.717 | 345.3 Da LogP -1.93 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(N)(N)=O)[C@@H](…
|
| ZINC1842158 ZINC | 0.717 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@H](O…
|
| ZINC204538551 ZINC | 0.717 | 345.3 Da LogP -1.93 TPSA 197.6 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(N)(N)=O)[C@@H](…
|
| ZINC2046931 ZINC | 0.717 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@H](…
|
| ZINC2126310 ZINC | 0.717 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3201891 ZINC | 0.717 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC3201893 ZINC | 0.717 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3830180 ZINC | 0.717 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3860156 ZINC | 0.717 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3977897 ZINC | 0.717 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](COP(=O)(O)O)[C@@H](O…
|
| ZINC4806442 ZINC | 0.717 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
| ZINC8613167 ZINC | 0.717 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
| ZINC28567519 ZINC | 0.717 | 466.4 Da LogP -1.00 TPSA 215.5 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(=O)(=O)/N=C(\O)…
|
| ZINC5615251 ZINC | 0.709 | 375.3 Da LogP -0.55 TPSA 164.1 | 1 viol. | ✓ Clean |
COP(=O)(OC)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@…
|
| ZINC5615253 ZINC | 0.709 | 375.3 Da LogP -0.55 TPSA 164.1 | 1 viol. | ✓ Clean |
COP(=O)(OC)OC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C…
|
| ZINC5615258 ZINC | 0.709 | 375.3 Da LogP -0.55 TPSA 164.1 | 1 viol. | ✓ Clean |
COP(=O)(OC)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@…
|
| ZINC5615263 ZINC | 0.709 | 375.3 Da LogP -0.55 TPSA 164.1 | 1 viol. | ✓ Clean |
COP(=O)(OC)OC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.