KpKP13 Protein target profile

putative murein peptide carboxypeptidase

Accession: KP13_05059

Gene: AHE44185.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GTZ2
Length 345
Pocket druggability (P2Rank · AlphaFold DB model) 0.809
Direct ligand evidence 0 58 total records
Functional annotation 0 EC 3 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
95.81 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.809
Structure A0A0H3GTZ2
Pocket Pocket 1
Druggability (FPocket) 0.447
Structure A0A0H3GTZ2
Pocket Pocket 2
ColabFold model
P2Rank 0.843 · Pocket 1
FPocket 0.544 · Pocket 2
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 3 / 4744 genomes with a hit
Prevalence 0.1%

Sequence

Primary amino-acid sequence viewer.

MSVLFPPRLAPGDVIGVTAPSSGVPEHLHPRLELAIKNLKKRGYQVREGRCLRSQHKNKSATKFSRVEELMSYLTDPDIKAVMPRWGGDLAMELLDLIDFDLLSRSKPKWFVGFSDLSTLHFPLTTISGWATLHGPNLMDLGAQKLDATTQAVWEILESNRGTVIKQYSSTAFQADENQWGTASDGGFNLTQKTQWKRLDGVTSSLTFSGKLIGGCLEIISRLAGTPFGNVPLFKASNSPQGIILYFENVEMAPCELTRALFSLRLQGWFDNLNGVLIGRSAAPDVSDPTKHNYLDALKAAFENIAVPVLYDVDIGHIPPQISLVNGADATVFFAENGSWVTQQL

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
Unknown

Gene Ontology (GO)

3
  • GO:0004180 Catalysis of the hydrolysis of a single C-terminal amino acid residue from a polypeptide chain.
  • GO:0008236 Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
  • GO:0006508 The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

17 records
Show feature table
Start End DB Term Name
15 135 Pfam PF02016 LD-carboxypeptidase N-terminal domain
15 135 InterPro IPR040449 LD-carboxypeptidase, N-terminal
1 337 PANTHER PTHR30237 MURAMOYLTETRAPEPTIDE CARBOXYPEPTIDASE
1 337 InterPro IPR003507 Peptidase family S66
2 168 SUPERFAMILY SSF52317 Class I glutamine amidotransferase-like
2 168 InterPro IPR029062 Class I glutamine amidotransferase-like
13 332 CDD cd07062 Peptidase_S66_mccF_like
166 344 Gene3D G3DSA:3.50.30.60 -
166 344 InterPro IPR027461 LD-carboxypeptidase A, C-terminal domain superfamily
2 160 Gene3D G3DSA:3.40.50.10740 -
2 160 InterPro IPR027478 Murein tetrapeptide carboxypeptidase, N-terminal
205 334 SUPERFAMILY SSF141986 LD-carboxypeptidase A C-terminal domain-like
205 334 InterPro IPR027461 LD-carboxypeptidase A, C-terminal domain superfamily
3 345 PIRSF PIRSF028757 LD-carboxypeptidase
3 345 InterPro IPR003507 Peptidase family S66
209 332 Pfam PF17676 LD-carboxypeptidase C-terminal domain
209 332 InterPro IPR040921 LD-carboxypeptidase, C-terminal

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.809
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.004
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.001
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #2
0.447
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GTZ2
AlphaFold DB full sequence Viewing
ColabFold KP13_05059
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 8 records from similar proteins
Structural ligands 8 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
1EG PDB via homolog 491.4 Da · LogP -4.11 · TPSA 275.1 Open detail RCSB PDB
1EI PDB via homolog Detail RCSB PDB
7MD PDB via homolog Detail RCSB PDB
A5A PDB via homolog Detail RCSB PDB
DSZ PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
1EG RCSB PDB Q47511 491.4 Da LogP -4.11 TPSA 275.1 2 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)COS(=O)(=…
1EI RCSB PDB Q47511 476.4 Da LogP -3.69 TPSA 249.0 2 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)COS(=O)(=…
7MD RCSB PDB Q47511 518.4 Da LogP -2.56 TPSA 273.3 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
A5A RCSB PDB A0A6L8PEJ7 417.4 Da LogP -3.25 TPSA 217.8 1 viol. ✓ Clean C[C@@H](C(=O)NS(=O)(=O)OC[C@@H]1[C@H]([C@H]([C@…
DSZ RCSB PDB A0A6L8PEJ7 461.4 Da LogP -3.79 TPSA 255.1 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
GSU RCSB PDB Q47511 475.4 Da LogP -3.40 TPSA 255.1 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
LMS RCSB PDB Q8Y6P6 346.3 Da LogP -2.75 TPSA 188.7 1 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
SBT RCSB PDB Q734X3 74.1 Da LogP 0.78 TPSA 20.2 ✓ Ro5 ✓ Clean CC[C@H](C)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.