KpKP13 Protein target profile

putative sensor histidine protein kinase

Accession: KP13_05061

Gene: AHE44187.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GPB5
Length 353
Pocket druggability (P2Rank · AlphaFold DB model) 0.937
Direct ligand evidence 0 54 total records
Functional annotation 0 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
85.29 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.937
Structure A0A0H3GPB5
Pocket Pocket 1
Druggability (FPocket) 0.825
Structure A0A0H3GPB5
Pocket Pocket 1
ColabFold model
P2Rank 0.947 · Pocket 1
FPocket 0.104 · Pocket 4
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 18 / 4744 genomes with a hit
Prevalence 0.4%

Sequence

Primary amino-acid sequence viewer.

MNKETILSRQILTYMLLLTFVIIAIAILGSYLFYSFLIYYLPGGMNEGSEDAMTFLDWMWILMASITSLVVALFFTVKLSARIFNPLNDVAYSLKQISQGNLSARAFNSSSKLGEMNRLVNDFNEMAEKLQTLDAQRNLWNAAIAHELRTPVTILRGRLQGLVDGVFEPEPSLFRNLLKQTEGLTNLIEDLRVVSSSGGAGYSLMLSEVDLKATISNALDTFWPDFDKKHFKIVTEINQQYCVCDPLRIIQCLTVLFDNALKYSTSQTLLIKNGITGNDNFIIVQDQGPGIPEELLKSLFQPFQRGEYAKNINPEGCGLGLSVVKAIMCAHGGDVSYSLTPENGSLFKLSWPV

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

5
  • GO:0016310 The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
  • GO:0016772 Catalysis of the transfer of a phosphorus-containing group from one compound (donor) to another (acceptor).
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0000155 Catalysis of the phosphorylation of a histidine residue in response to detection of an extracellular signal such as a chemical ligand or change in environment, to initiate a change in cell state or activity. The two-component sensor is a histidine kinase that autophosphorylates a histidine residue in its active site. The phosphate is then transferred to an aspartate residue in a downstream response regulator, to trigger a response.
  • GO:0007165 The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

42 records
Show feature table
Start End DB Term Name
81 135 SMART SM00304 HAMP_11
81 135 InterPro IPR003660 HAMP domain
249 351 CDD cd00075 HATPase
245 352 Pfam PF02518 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
245 352 InterPro IPR003594 Histidine kinase/HSP90-like ATPase
58 77 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
143 353 ProSiteProfiles PS50109 Histidine kinase domain profile.
143 353 InterPro IPR005467 Histidine kinase domain
12 34 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
47 133 Gene3D G3DSA:6.10.340.10 -
81 135 ProSiteProfiles PS50885 HAMP domain profile.
134 195 CDD cd00082 HisKA
134 195 InterPro IPR003661 Signal transduction histidine kinase, dimerisation/phosphoacceptor domain
315 333 PRINTS PR00344 Bacterial sensor protein C-terminal signature
315 333 InterPro IPR004358 Signal transduction histidine kinase-related protein, C-terminal
280 294 PRINTS PR00344 Bacterial sensor protein C-terminal signature
280 294 InterPro IPR004358 Signal transduction histidine kinase-related protein, C-terminal
339 352 PRINTS PR00344 Bacterial sensor protein C-terminal signature
339 352 InterPro IPR004358 Signal transduction histidine kinase-related protein, C-terminal
298 308 PRINTS PR00344 Bacterial sensor protein C-terminal signature
298 308 InterPro IPR004358 Signal transduction histidine kinase-related protein, C-terminal
39 57 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
116 136 Coils Coil Coil
1 11 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
54 76 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
244 353 SMART SM00387 HKATPase_4
244 353 InterPro IPR003594 Histidine kinase/HSP90-like ATPase
82 132 SUPERFAMILY SSF158472 HAMP domain-like
78 353 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
60 349 PANTHER PTHR45528 SENSOR HISTIDINE KINASE CPXA
86 130 CDD cd06225 HAMP
119 195 SUPERFAMILY SSF47384 Homodimeric domain of signal transducing histidine kinase
119 195 InterPro IPR036097 Signal transduction histidine kinase, dimerisation/phosphoacceptor domain superfamily
206 353 SUPERFAMILY SSF55874 ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
206 353 InterPro IPR036890 Histidine kinase/HSP90-like ATPase superfamily
134 197 Gene3D G3DSA:1.10.287.130 -
12 38 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
206 353 Gene3D G3DSA:3.30.565.10 -
140 198 Pfam PF00512 His Kinase A (phospho-acceptor) domain
140 198 InterPro IPR003661 Signal transduction histidine kinase, dimerisation/phosphoacceptor domain
136 200 SMART SM00388 HisKA_10
136 200 InterPro IPR003661 Signal transduction histidine kinase, dimerisation/phosphoacceptor domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.937
Likely same site as FPocket 1 2.2 Å 29 shared residues 94% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.825 Unusual size
Likely same site as P2Rank 1 2.2 Å 29 shared residues 94% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GPB5
AlphaFold DB full sequence Viewing
ColabFold KP13_05061
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

54 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 4 records from similar proteins
Structural ligands 4 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
ANP PDB via homolog 506.2 Da · LogP -2.06 · TPSA 281.9 Open detail RCSB PDB
EMC PDB via homolog Detail RCSB PDB
EMT PDB via homolog Detail RCSB PDB
PG0 PDB via homolog Detail RCSB PDB
ZINC1580161 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ANP RCSB PDB P0AE82 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
EMC RCSB PDB Q9X180 229.7 Da LogP 0.97 TPSA 0.0 ✓ Ro5 ✓ Clean CC[Hg+]
EMT RCSB PDB Q9X180 382.8 Da LogP 2.91 TPSA 37.3 ✓ Ro5 ✓ Clean CC[Hg]Sc1ccccc1C(=O)O
PG0 RCSB PDB P71815 120.1 Da LogP -0.36 TPSA 38.7 ✓ Ro5 ✓ Clean COCCOCCO

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.