KpKP13 Protein target profile

Acetoin(diacetyl) reductase

Accession: KP13_05080

Gene: AHE44198.1 budC 3D evidence: Experimental + ColabFold model UniProt Q48436
Length 256
Pocket druggability (P2Rank · Experimental) 0.958
Direct ligand evidence 0 56 total records
Functional annotation 1 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
41.86 Lower values reduce human off-target concern.
Human E-value
7.64e-11
Gut microbiome similarity
3.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
40.784 Higher values support similarity to known essential genes.
DEG E-value
3.27e-36 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
97.24 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

PDB experimental structure

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.958
Structure 3WYE
Pocket Pocket 1
Druggability (FPocket) 0.457
Structure 1GEG
Pocket Pocket 5
ColabFold model
P2Rank 0.947 · Pocket 1
FPocket 0.71 · Pocket 6
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 152 / 4744 genomes with a hit
Prevalence 3.2%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MKKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGRAMAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGKPLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVFN

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0019152 Catalysis of the reaction: acetoin + NAD+ = diacetyl + NADH + H+. This reaction is catalyzed in the reverse direction.
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0045150 The chemical reactions and pathways resulting in the breakdown of acetoin, 3-hydroxy-2-butanone.
  • GO:0052588 Catalysis of the reaction: (S)-acetoin + NAD+ = diacetyl + H+ + NADH. This reaction is catalyzed in the reverse direction.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

34 records
Show feature table
Start End DB Term Name
3 183 SMART SM00822 This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
78 89 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
78 89 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
152 171 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
152 171 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
132 140 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
132 140 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
1 256 FunFam G3DSA:3.40.50.720:FF:000084 Short-chain dehydrogenase reductase
3 196 Pfam PF00106 short chain dehydrogenase
3 196 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
1 256 CDD cd05366 meso-BDH-like_SDR_c
1 3 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
1 256 Gene3D G3DSA:3.40.50.720 -
3 256 NCBIfam TIGR02415 acetoin reductase
3 256 InterPro IPR014007 Acetoin reductase
4 11 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
2 255 PANTHER PTHR24321 DEHYDROGENASES, SHORT CHAIN
1 19 Phobius SIGNAL_PEPTIDE Signal peptide region
2 254 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
2 254 InterPro IPR036291 NAD(P)-binding domain superfamily
173 190 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
173 190 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
4 21 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
4 21 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
126 142 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
126 142 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
78 89 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
152 171 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
217 237 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
217 237 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
12 19 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
139 167 ProSitePatterns PS00061 Short-chain dehydrogenases/reductases family signature.
139 167 InterPro IPR020904 Short-chain dehydrogenase/reductase, conserved site
20 256 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.958
Show in viewer
Surrounding area
All structural evidence 2 experimental · 1 predicted

Structural evidence

2 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 3WYE
X-ray 1.58 Å A,B
100.0% 1-256
Viewing
PDB 1GEG
X-ray 1.70 Å A,B,C,D,E,F,G,H
100.0% 1-256
Loaded
ColabFold KP13_05080
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

56 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 6 records from similar proteins
Structural ligands 6 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
A6O PDB via homolog 314.4 Da · LogP 3.93 · TPSA 46.5 Open detail RCSB PDB
AOI PDB via homolog Detail RCSB PDB
F3V PDB via homolog Detail RCSB PDB
RM4 PDB via homolog Detail RCSB PDB
TAM PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
A6O RCSB PDB C0IR58 314.4 Da LogP 3.93 TPSA 46.5 ✓ Ro5 ✓ Clean CC[C@]1([C@H](CCC1=O)O)C/C=C/2\CCCc3c2ccc(c3)OC
AOI RCSB PDB P9WGT1 290.4 Da LogP 3.96 TPSA 37.3 ✓ Ro5 ✓ Clean C[C@]12CC[C@H](C[C@@H]1CC[C@@H]3[C@@H]2CC[C@]4(…
F3V RCSB PDB A0QP46 73.1 Da LogP -0.47 TPSA 43.1 ✓ Ro5 ✓ Clean CC(=O)CN
RM4 RCSB PDB C1DMX5 164.2 Da LogP -2.19 TPSA 90.2 ✓ Ro5 ✓ Clean C[C@H]1[C@@H]([C@H]([C@H]([C@H](O1)O)O)O)O
TAM RCSB PDB C0IR58 163.2 Da LogP -1.17 TPSA 86.7 ✓ Ro5 ✓ Clean C(CO)C(CCO)(CCO)N
TLA RCSB PDB B4EEX4 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@@H]([C@H](C(=O)O)O)(C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.