Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 41.86 Lower values reduce human off-target concern.
- Human E-value
- 7.64e-11
- Gut microbiome similarity
- 3.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 40.784 Higher values support similarity to known essential genes.
- DEG E-value
- 3.27e-36 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 97.24 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
PDB experimental structureP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MKKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGRAMAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGKPLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVFN
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
4- GO:0019152 Catalysis of the reaction: acetoin + NAD+ = diacetyl + NADH + H+. This reaction is catalyzed in the reverse direction.
- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
- GO:0045150 The chemical reactions and pathways resulting in the breakdown of acetoin, 3-hydroxy-2-butanone.
- GO:0052588 Catalysis of the reaction: (S)-acetoin + NAD+ = diacetyl + H+ + NADH. This reaction is catalyzed in the reverse direction.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 3 | 183 | SMART | SM00822 | This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group. |
| 78 | 89 | PRINTS | PR00080 | Short-chain dehydrogenase/reductase (SDR) superfamily signature |
| 78 | 89 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 152 | 171 | PRINTS | PR00080 | Short-chain dehydrogenase/reductase (SDR) superfamily signature |
| 152 | 171 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 132 | 140 | PRINTS | PR00080 | Short-chain dehydrogenase/reductase (SDR) superfamily signature |
| 132 | 140 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 1 | 256 | FunFam | G3DSA:3.40.50.720:FF:000084 | Short-chain dehydrogenase reductase |
| 3 | 196 | Pfam | PF00106 | short chain dehydrogenase |
| 3 | 196 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 1 | 256 | CDD | cd05366 | meso-BDH-like_SDR_c |
| 1 | 3 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 1 | 256 | Gene3D | G3DSA:3.40.50.720 | - |
| 3 | 256 | NCBIfam | TIGR02415 | acetoin reductase |
| 3 | 256 | InterPro | IPR014007 | Acetoin reductase |
| 4 | 11 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 2 | 255 | PANTHER | PTHR24321 | DEHYDROGENASES, SHORT CHAIN |
| 1 | 19 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 2 | 254 | SUPERFAMILY | SSF51735 | NAD(P)-binding Rossmann-fold domains |
| 2 | 254 | InterPro | IPR036291 | NAD(P)-binding domain superfamily |
| 173 | 190 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 173 | 190 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 4 | 21 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 4 | 21 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 126 | 142 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 126 | 142 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 78 | 89 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 152 | 171 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 217 | 237 | PRINTS | PR00081 | Glucose/ribitol dehydrogenase family signature |
| 217 | 237 | InterPro | IPR002347 | Short-chain dehydrogenase/reductase SDR |
| 12 | 19 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 139 | 167 | ProSitePatterns | PS00061 | Short-chain dehydrogenases/reductases family signature. |
| 139 | 167 | InterPro | IPR020904 | Short-chain dehydrogenase/reductase, conserved site |
| 20 | 256 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
2 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| A6O RCSB PDB | C0IR58 | 314.4 Da LogP 3.93 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
CC[C@]1([C@H](CCC1=O)O)C/C=C/2\CCCc3c2ccc(c3)OC
|
|
| AOI RCSB PDB | P9WGT1 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H](C[C@@H]1CC[C@@H]3[C@@H]2CC[C@]4(…
|
|
| F3V RCSB PDB | A0QP46 | 73.1 Da LogP -0.47 TPSA 43.1 | ✓ Ro5 | ✓ Clean |
CC(=O)CN
|
|
| RM4 RCSB PDB | C1DMX5 | 164.2 Da LogP -2.19 TPSA 90.2 | ✓ Ro5 | ✓ Clean |
C[C@H]1[C@@H]([C@H]([C@H]([C@H](O1)O)O)O)O
|
|
| TAM RCSB PDB | C0IR58 | 163.2 Da LogP -1.17 TPSA 86.7 | ✓ Ro5 | ✓ Clean |
C(CO)C(CCO)(CCO)N
|
|
| TLA RCSB PDB | B4EEX4 | 150.1 Da LogP -2.12 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
[C@@H]([C@H](C(=O)O)O)(C(=O)O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1691401 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@H](O)CC[C@]43…
|
| ZINC253497590 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H](O)C[C@@H]1CC[C@H]1[C@H]2CC[C@@]2…
|
| ZINC253497948 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@H](O)CC[C@]43…
|
| ZINC253928529 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@@H]4C[C@@H](O)CC[C@]…
|
| ZINC38145858 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@H](O)CC[C@@]4…
|
| ZINC38145859 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@@H](CC[C@H]4C[C@H](O)CC[C@@]…
|
| ZINC3849577 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H](O)C[C@@H]1CC[C@@H]1[C@@H]2CC[C@]…
|
| ZINC3849581 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@@H](CC[C@H]4C[C@@H](O)CC[C@@…
|
| ZINC3849584 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@@H](O)CC[C@@]…
|
| ZINC3849784 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@@H](CC[C@H]4C[C@H](O)CC[C@@]…
|
| ZINC3849785 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@H](O)CC[C@@]4…
|
| ZINC3861550 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](CC[C@H]4C[C@H](O)CC[C@@]4…
|
| ZINC3861661 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](CC[C@H]4C[C@@H](O)CC[C@@]…
|
| ZINC3869419 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H](O)C[C@@H]1CC[C@@H]1[C@@H]2CC[C@@…
|
| ZINC3875364 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](CC[C@@H]4C[C@H](O)CC[C@]3…
|
| ZINC4073949 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@@H](CC[C@H]4C[C@@H](O)CC[C@@…
|
| ZINC4743888 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](CC[C@@H]4C[C@@H](O)CC[C@]…
|
| ZINC7996759 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@@H](O)CC[C@@]…
|
| ZINC81132361 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@@H]4C[C@@H](O)CC[C@@…
|
| ZINC81132362 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@@H]4C[C@@H](O)CC[C@@…
|
| ZINC82230076 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H](O)C[C@@H]1CC[C@@H]1[C@@H]2CC[C@@…
|
| ZINC9231975 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H](O)C[C@@H]1CC[C@H]1[C@H]2CC[C@@]…
|
| ZINC948 ZINC | 1.000 | 290.4 Da LogP 3.96 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@@H]4C[C@@H](O)CC[C@]…
|
| ZINC257345656 ZINC | 0.854 | 304.5 Da LogP 4.35 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@H](O)CC[C@]43…
|
| ZINC257345657 ZINC | 0.854 | 304.5 Da LogP 4.35 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@H](O)CC[C@@]4…
|
| ZINC257345658 ZINC | 0.854 | 304.5 Da LogP 4.35 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@H](O)CC[C@]43…
|
| ZINC257345659 ZINC | 0.854 | 304.5 Da LogP 4.35 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@H](O)CC[C@@]4…
|
| ZINC254714590 ZINC | 0.721 | 292.4 Da LogP 4.94 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@H](F)CC[C@@]4…
|
| ZINC257346299 ZINC | 0.721 | 292.4 Da LogP 4.94 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@H](F)CC[C@]43…
|
| ZINC257346300 ZINC | 0.721 | 292.4 Da LogP 4.94 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@H](F)CC[C@]43…
|
| ZINC257346301 ZINC | 0.721 | 292.4 Da LogP 4.94 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CC[C@H]4C[C@H](F)CC[C@@]4…
|
| ZINC118914949 ZINC | 0.711 | 316.5 Da LogP 4.80 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H]1CC[C@]2(C)[C@H]3CC[C@]4(C)C(=O)CC[…
|
| ZINC118914950 ZINC | 0.711 | 316.5 Da LogP 4.80 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@]2(C)[C@H]3CC[C@]4(C)C(=O)CC[C…
|
| ZINC118914951 ZINC | 0.711 | 316.5 Da LogP 4.80 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H]1CC[C@@]2(C)[C@@H](CC[C@H]3[C@@H]4C…
|
| ZINC118914952 ZINC | 0.711 | 316.5 Da LogP 4.80 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@@]2(C)[C@@H](CC[C@H]3[C@@H]4CC…
|
| ZINC13399905 ZINC | 0.711 | 316.5 Da LogP 4.80 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@@]2(C)[C@@H](CC[C@@H]3[C@@H]2C…
|
| ZINC2049238309 ZINC | 0.711 | 316.5 Da LogP 4.80 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@@]2(C)[C@@H](CC[C@@H]3[C@@H]2C…
|
| ZINC2049238310 ZINC | 0.711 | 316.5 Da LogP 4.80 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@@]2(C)[C@@H](CC[C@@H]3[C@@H]2C…
|
| ZINC245239066 ZINC | 0.711 | 316.5 Da LogP 4.80 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H]1CC[C@@]2(C)[C@@H](CC[C@@H]3[C@H]4C…
|
| ZINC245239069 ZINC | 0.711 | 316.5 Da LogP 4.80 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@@]2(C)[C@@H](CC[C@@H]3[C@H]4CC…
|
| ZINC253611246 ZINC | 0.711 | 316.5 Da LogP 4.80 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@@]2(C)[C@@H](CC[C@H]3[C@H]2CC[…
|
| ZINC253611248 ZINC | 0.711 | 316.5 Da LogP 4.80 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H]1CC[C@@]2(C)[C@@H](CC[C@H]3[C@H]2CC…
|
| ZINC118930984 ZINC | 0.698 | 306.4 Da LogP 2.93 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](C[C@@H](O)[C@H]4C[C@@H](O…
|
| ZINC118930985 ZINC | 0.698 | 306.4 Da LogP 2.93 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](C[C@@H](O)[C@H]4C[C@H](O)…
|
| ZINC118930986 ZINC | 0.698 | 306.4 Da LogP 2.93 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](C[C@@H](O)[C@@H]4C[C@@H](…
|
| ZINC118930987 ZINC | 0.698 | 306.4 Da LogP 2.93 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](C[C@@H](O)[C@@H]4C[C@H](O…
|
| ZINC19943608 ZINC | 0.696 | 304.4 Da LogP 3.14 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@]12CC(=O)[C@H]3[C@@H](CC[C@@H]4C[C@@H](O)CC…
|
| ZINC2382313444 ZINC | 0.696 | 304.5 Da LogP 4.21 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@H]1C[C@@]2(C)C(=O)CC[C@H]2[C@@H]2CC[C@H]3C[…
|
| ZINC247643489 ZINC | 0.696 | 304.4 Da LogP 3.14 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@]12CC(=O)[C@@H]3[C@H](CC[C@H]4C[C@H](O)CC[C…
|
| ZINC253614914 ZINC | 0.696 | 304.4 Da LogP 3.14 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@]12CC(=O)[C@@H]3[C@H](CC[C@@H]4C[C@H](O)CC[…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.