Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 58.333 Lower values reduce human off-target concern.
- Human E-value
- 2.27e-07
- Gut microbiome similarity
- 12.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 70.466 Higher values support similarity to known essential genes.
- DEG E-value
- 3.85e-101 Smaller values mean stronger essential-gene similarity.
Localization
- Localization
- Periplasmic
Structure confidence
- ColabFold pLDDT
- 98.19 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MSFELPALPYAKDALAPHISAETLEYHYGKHHQAYVTNLNNLIKGTAFEGKSLEEIVRTSEGGVFNNAAQVWNHTFYWNCLAPNAGGEPEGELAAAIAKSFGSFADFKAKFTDAAAKNFGAGWTWLVKNADGSLAIVSTSNAGTPLTTDAKPLLTVDVWEHAYYIDYRNARPSYLDHFWALVNWKFVAANLAA
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
5- GO:0004784 Catalysis of the reaction: 2 superoxide + 2 H+ = O2 + H2O2.
- GO:0006801 The chemical reactions and pathways involving superoxide, the superoxide anion O2- (superoxide free radical), or any compound containing this species.
- GO:0046872 Binding to a metal ion.
- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
- GO:0046914 Binding to a transition metal ions; a transition metal is an element whose atom has an incomplete d-subshell of extranuclear electrons, or which gives rise to a cation or cations with an incomplete d-subshell. Transition metals often have more than one valency state. Biologically relevant transition metals include vanadium, manganese, iron, copper, cobalt, nickel, molybdenum and silver.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 193 | PIRSF | PIRSF000349 | MnSOD_FeSOD |
| 1 | 193 | InterPro | IPR001189 | Manganese/iron superoxide dismutase |
| 20 | 81 | FunFam | G3DSA:1.10.287.990:FF:000002 | Superoxide dismutase |
| 157 | 164 | ProSitePatterns | PS00088 | Manganese and iron superoxide dismutases signature. |
| 157 | 164 | InterPro | IPR019833 | Manganese/iron superoxide dismutase, binding site |
| 6 | 17 | PRINTS | PR01703 | Manganese superoxide dismutase signature |
| 6 | 17 | InterPro | IPR001189 | Manganese/iron superoxide dismutase |
| 155 | 167 | PRINTS | PR01703 | Manganese superoxide dismutase signature |
| 155 | 167 | InterPro | IPR001189 | Manganese/iron superoxide dismutase |
| 118 | 126 | PRINTS | PR01703 | Manganese superoxide dismutase signature |
| 118 | 126 | InterPro | IPR001189 | Manganese/iron superoxide dismutase |
| 27 | 40 | PRINTS | PR01703 | Manganese superoxide dismutase signature |
| 27 | 40 | InterPro | IPR001189 | Manganese/iron superoxide dismutase |
| 65 | 78 | PRINTS | PR01703 | Manganese superoxide dismutase signature |
| 65 | 78 | InterPro | IPR001189 | Manganese/iron superoxide dismutase |
| 2 | 82 | Pfam | PF00081 | Iron/manganese superoxide dismutases, alpha-hairpin domain |
| 2 | 82 | InterPro | IPR019831 | Manganese/iron superoxide dismutase, N-terminal |
| 82 | 193 | FunFam | G3DSA:3.55.40.20:FF:000001 | Superoxide dismutase |
| 81 | 193 | Gene3D | G3DSA:3.55.40.20 | - |
| 81 | 193 | InterPro | IPR036314 | Manganese/iron superoxide dismutase, C-terminal domain superfamily |
| 82 | 191 | SUPERFAMILY | SSF54719 | Fe,Mn superoxide dismutase (SOD), C-terminal domain |
| 82 | 191 | InterPro | IPR036314 | Manganese/iron superoxide dismutase, C-terminal domain superfamily |
| 89 | 189 | Pfam | PF02777 | Iron/manganese superoxide dismutases, C-terminal domain |
| 89 | 189 | InterPro | IPR019832 | Manganese/iron superoxide dismutase, C-terminal |
| 3 | 192 | PANTHER | PTHR42769 | SUPEROXIDE DISMUTASE |
| 1 | 84 | SUPERFAMILY | SSF46609 | Fe,Mn superoxide dismutase (SOD), N-terminal domain |
| 1 | 84 | InterPro | IPR036324 | Manganese/iron superoxide dismutase, N-terminal domain superfamily |
| 20 | 80 | Gene3D | G3DSA:1.10.287.990 | Fe,Mn superoxide dismutase (SOD) domain |
| 20 | 80 | InterPro | IPR036324 | Manganese/iron superoxide dismutase, N-terminal domain superfamily |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GYY6
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_05143
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| AZI RCSB PDB | P0AGD3 | 42.0 Da LogP 0.87 TPSA 58.7 | ✓ Ro5 | Alert |
[N-]=[N+]=[N-]
|
|
| MH2 RCSB PDB | P00448 | 71.9 Da LogP -0.56 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
O[Mn+2]
|
|
| MLI RCSB PDB | P41977 | 102.0 Da LogP -3.12 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(=O)[O-]
|
|
| O RCSB PDB | P0AGD3 | 18.0 Da LogP -0.82 TPSA 31.5 | ✓ Ro5 | ✓ Clean |
O
|
|
| PEO RCSB PDB | P00448 | 34.0 Da LogP 0.02 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
OO
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
No virtual-screening candidates for this protein.
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.