Genome KpKP13

Protein target profile

Lactoylglutathione lyase

Accession: KP13_05149

Gene: gloA AHE44268.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GYY2
Length 129
Pocket druggability (P2Rank · AlphaFold DB model) 0.021
Direct ligand evidence 0 127 total records
Functional annotation 1 EC 4 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
35.915 Lower values reduce human off-target concern.
Human E-value
1.03e-23
Gut microbiome similarity
3.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
95.38 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.021
Structure A0A0H3GYY2
Pocket Pocket 1
Druggability (FPocket) 0.282
Structure A0A0H3GYY2
Pocket Pocket 2
ColabFold model
P2Rank 0.019 · Pocket 1
FPocket 0.164 · Pocket 4
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 176 / 4744 genomes with a hit
Prevalence 3.7%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MLRVGDLQRSIDFYTNVLGMKLLRTSENPEYKYSLAFVGYGEESETAVIELTYNWGVDSYELGTAYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEEKDAGKGLGN

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0004462 Catalysis of the reaction: (R)-S-lactoylglutathione = glutathione + methylglyoxal.
  • GO:0046872 Binding to a metal ion.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0019243 OBSOLETE. The chemical reactions and pathways resulting in the breakdown of methylglyoxal, CH3-CO-CHO, into pyruvate via the intermediate (R)-S-lactoyl-glutathione. Glutathione is used in the first step of the pathway and then regenerated in the second step.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
1 127 Gene3D G3DSA:3.10.180.10 -
1 127 InterPro IPR029068 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
1 118 CDD cd16358 GlxI_Ni
1 122 NCBIfam TIGR00068 lactoylglutathione lyase
1 122 InterPro IPR004361 Glyoxalase I
1 120 ProSiteProfiles PS51819 Vicinal oxygen chelate (VOC) domain profile.
1 120 InterPro IPR037523 Vicinal oxygen chelate (VOC) domain
1 123 PANTHER PTHR46036 LACTOYLGLUTATHIONE LYASE
2 117 Pfam PF00903 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
2 117 InterPro IPR004360 Glyoxalase/fosfomycin resistance/dioxygenase domain
1 122 SUPERFAMILY SSF54593 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
1 122 InterPro IPR029068 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
63 75 ProSitePatterns PS00935 Glyoxalase I signature 2.
63 75 InterPro IPR018146 Glyoxalase I, conserved site
1 125 FunFam G3DSA:3.10.180.10:FF:000002 Lactoylglutathione lyase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.021
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.021
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.008
Likely same site as FPocket 2 2.3 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #2
0.282 Unusual size
Likely same site as P2Rank 3 2.3 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:122-122 Proton donor/acceptor
UniProt: Binding site:122-122
UniProt: Binding site:56-56
UniProt: Binding site:74-74
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GYY2
AlphaFold DB full sequence Viewing
ColabFold KP13_05149
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

127 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 77 records from similar proteins
Structural ligands 16 0 loaded crystals
Measured bioactivity 61 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
3WL PDB via homolog 270.2 Da · LogP 2.58 · TPSA 90.9 Open detail RCSB PDB
CBW PDB via homolog Detail RCSB PDB
E1L PDB via homolog Detail RCSB PDB
GIP PDB via homolog Detail RCSB PDB
GNB PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
3WL RCSB PDB Q9CPU0 270.2 Da LogP 2.58 TPSA 90.9 ✓ Ro5 Alert c1ccc(cc1)C2=CC(=O)c3c(cc(c(c3O)O)O)O2
CBW RCSB PDB Q9CPU0 470.7 Da LogP 6.41 TPSA 74.6 1 viol. ✓ Clean CC1([C@@H]2CC[C@@]3([C@@H]([C@]2(CC[C@@H]1O)C)C…
E1L RCSB PDB Q9CPU0 391.4 Da LogP 4.82 TPSA 40.3 ✓ Ro5 Alert c1ccc2c(c1)c3c([nH]2)CN(CC3)C(=S)Nc4ccc(cc4)OC(…
GIP RCSB PDB Q04760 570.4 Da LogP -0.63 TPSA 202.5 2 viol. ✓ Clean c1cc(ccc1N(C(O)SC[C@@H](C(=O)NCC(=O)O)NC(=O)CC[…
GNB RCSB PDB Q04760 488.5 Da LogP -1.00 TPSA 231.4 1 viol. ✓ Clean c1cc(ccc1COC(O)SC[C@@H](C(=O)NCC(=O)O)NC(=O)CC[…
GSB RCSB PDB Q04760 397.5 Da LogP -0.20 TPSA 158.8 ✓ Ro5 ✓ Clean c1ccc(cc1)CSC[C@@H](C(=O)NCC(=O)O)NC(=O)CC[C@@H…
GSH RCSB PDB B6TPH0 307.3 Da LogP -2.21 TPSA 158.8 1 viol. ✓ Clean C(CC(=O)N[C@@H](CS)C(=O)NCC(=O)O)[C@@H](C(=O)O)N
GTX RCSB PDB Q04760 392.5 Da LogP -0.54 TPSA 160.4 ✓ Ro5 ✓ Clean CCCCCCSC[C@@H](C(=O)NCC(=O)O)NC(=O)CC[C@@H](C(=…
HPU RCSB PDB Q04760 356.4 Da LogP 2.79 TPSA 88.4 ✓ Ro5 ✓ Clean CS(=O)(=O)Nc1cccc(c1)C2=CC(=CC(=O)N2O)c3ccccc3
HPW RCSB PDB Q04760 449.5 Da LogP 2.16 TPSA 134.6 ✓ Ro5 ✓ Clean CS(=O)(=O)Nc1cc(cc(c1)NS(=O)(=O)C)C2=CC(=CC(=O)…
IMN RCSB PDB Q9CPU0 357.8 Da LogP 3.93 TPSA 68.5 ✓ Ro5 ✓ Clean Cc1c(c2cc(ccc2n1C(=O)c3ccc(cc3)Cl)OC)CC(=O)O
MGI RCSB PDB Q9CPU0 304.3 Da LogP 3.00 TPSA 96.2 ✓ Ro5 Alert Cc1cc(c(c(c1)Oc2cc(c(c(c2)O)C(=O)OC)C)O)O
SIN RCSB PDB Q9I5L8 118.1 Da LogP -0.06 TPSA 74.6 ✓ Ro5 ✓ Clean C(CC(=O)O)C(=O)O
TAM RCSB PDB Q9I5L8 163.2 Da LogP -1.17 TPSA 86.7 ✓ Ro5 ✓ Clean C(CO)C(CCO)(CCO)N
ZBF RCSB PDB Q9CPU0 448.4 Da LogP -0.95 TPSA 199.4 1 viol. ✓ Clean C#Cc1cccc(c1)N(C(=O)CCC(C(=O)NCC(=O)O)NC(=O)CCC…
ZST RCSB PDB Q9CPU0 419.4 Da LogP 3.70 TPSA 85.1 ✓ Ro5 ✓ Clean c1ccc2c(c1)C(=NN(C2=O)Cc3nc4cc(ccc4s3)C(F)(F)F)…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.