Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 2.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 97.85 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
PDB experimental structureP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSEAKLFSPLKVGAVTVPNRVFMAPLTRLRSIEPGDIPTPLMGEYYRQRASSGLIITEATQISAQAKGYAGAPGLHSPEQIAAWQKITAGVHAENGHIAVQLWHTGRISHSSLQPGGAAPVAPSALSAGTRTSLRDENGHAIRVDTSMPRALETAEIPGIVNDFRQAVGNARDAGFDLVELHSAHGYLLHQFLSPSANQRTDQYGGSVENRARLVLEVVDAVSQEWSAERIGIRVSPIGSFQNVDNGPNEEEDALYLISELAKRGIAYLHMSEPDWAGGKPYSEAFRQKVRDRFPGVIIGAGAYTVEKANDLINKGLIDAVAFGRDYIANPDLVARLQKKAPLNPQRPESFYGGGAEGYTDYPTL
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
4- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
- GO:0010181 Binding to flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0016628 Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces NAD or NADP.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 5 | 344 | Pfam | PF00724 | NADH:flavin oxidoreductase / NADH oxidase family |
| 5 | 344 | InterPro | IPR001155 | NADH:flavin oxidoreductase/NADH oxidase, N-terminal |
| 4 | 364 | PANTHER | PTHR22893 | NADH OXIDOREDUCTASE-RELATED |
| 4 | 364 | InterPro | IPR045247 | Oxidoreductase Oye-like |
| 3 | 365 | Gene3D | G3DSA:3.20.20.70 | Aldolase class I |
| 3 | 365 | InterPro | IPR013785 | Aldolase-type TIM barrel |
| 3 | 365 | FunFam | G3DSA:3.20.20.70:FF:000059 | N-ethylmaleimide reductase, FMN-linked |
| 5 | 345 | CDD | cd02933 | OYE_like_FMN |
| 4 | 364 | SUPERFAMILY | SSF51395 | FMN-linked oxidoreductases |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
1 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 1L5 RCSB PDB | O31246 | 163.2 Da LogP 2.32 TPSA 43.1 | ✓ Ro5 | ✓ Clean |
C/C(=C\N(=O)=O)/c1ccccc1
|
|
| 8OZ RCSB PDB | O31246 | 148.2 Da LogP 1.78 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C=C(c1ccccc1)C(=O)O
|
|
| A2Q RCSB PDB | P71278 | 96.1 Da LogP 1.30 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
C1CC=CC(=O)C1
|
|
| ANB RCSB PDB | P71278 | 284.4 Da LogP 3.86 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@H]([C@@H]1CCC2=O)CCC4=CC(=O)C…
|
|
| BEN RCSB PDB | K9TVC9 | 120.2 Da LogP 0.97 TPSA 49.9 | ✓ Ro5 | ✓ Clean |
[H]/N=C(\c1ccccc1)/N
|
|
| DNF RCSB PDB | P71278 | 184.1 Da LogP 1.21 TPSA 106.5 | ✓ Ro5 | ✓ Clean |
c1cc(c(cc1[N+](=O)[O-])[N+](=O)[O-])O
|
|
| FNR RCSB PDB | P71278 | 458.4 Da LogP -0.93 TPSA 208.4 | 1 viol. | ✓ Clean |
Cc1cc2c(cc1C)N(C3=C(N2)C(=O)NC(=O)N3)C[C@@H]([C…
|
|
| HBA RCSB PDB | O31246 | 122.1 Da LogP 1.20 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1C=O)O
|
|
| KSW RCSB PDB | M2XAQ9 | 94.1 Da LogP 1.07 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CC1=CC=CC1=O
|
|
| NYH RCSB PDB | P71278 | 127.1 Da LogP 1.72 TPSA 43.1 | ✓ Ro5 | ✓ Clean |
C1CCC(=CC1)[N+](=O)[O-]
|
|
| P7Y RCSB PDB | P71278 | 165.1 Da LogP 1.64 TPSA 63.4 | ✓ Ro5 | ✓ Clean |
c1ccc(c(c1)/C=C/[N+](=O)[O-])O
|
|
| P80 RCSB PDB | P71278 | 165.1 Da LogP 1.64 TPSA 63.4 | ✓ Ro5 | ✓ Clean |
c1cc(cc(c1)O)/C=C/[N+](=O)[O-]
|
|
| P81 RCSB PDB | P71278 | 165.1 Da LogP 1.64 TPSA 63.4 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1/C=C/[N+](=O)[O-])O
|
|
| PDN RCSB PDB | P71278 | 358.4 Da LogP 3.16 TPSA 94.8 | ✓ Ro5 | ✓ Clean |
C[C@]12CC(=O)[C@H]3[C@H]([C@@H]1CC[C@@]2(C(=CO)…
|
|
| STR RCSB PDB | P71278 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@@H]2[C@@]1(CC[C@H]3[C@H]2CCC4=…
|
|
| TNF RCSB PDB | P71278 | 229.1 Da LogP 1.12 TPSA 149.7 | ✓ Ro5 | ✓ Clean |
c1c(cc(c(c1[N+](=O)[O-])O)[N+](=O)[O-])[N+](=O)…
|
|
| TNL RCSB PDB | P71278 | 227.1 Da LogP 1.72 TPSA 129.4 | ✓ Ro5 | ✓ Clean |
Cc1c(cc(cc1[N+](=O)[O-])[N+](=O)[O-])[N+](=O)[O…
|
|
| TXD RCSB PDB | Q51990 | 667.5 Da LogP -3.30 TPSA 317.6 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| U5N RCSB PDB | M2XAQ9 | 98.1 Da LogP 0.49 TPSA 26.3 | ✓ Ro5 | ✓ Clean |
C[C@@H]1C=CC(=O)O1
|
|
| U6W RCSB PDB | M2XAQ9 | 98.1 Da LogP 0.84 TPSA 26.3 | ✓ Ro5 | ✓ Clean |
CC1=CCC(=O)O1
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC13521486 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@@H]2[C@@H]3CCC4=CC(=O)CC[C@]4(…
|
| ZINC13542968 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[C@@]4(…
|
| ZINC14880028 ZINC | 1.000 | 227.1 Da LogP 1.72 TPSA 129.4 | ✓ Ro5 | ✓ Clean |
Cc1c([N+](=O)[O-])cc([N+](=O)[O-])cc1[N+](=O)[O…
|
| ZINC156796 ZINC | 1.000 | 284.4 Da LogP 3.86 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@]12C=CC(=O)C=C1CC[C@@H]1[C@@H]2CC[C@@]2(C)C…
|
| ZINC1683141 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[C@]4(…
|
| ZINC1883067 ZINC | 1.000 | 229.1 Da LogP 1.12 TPSA 149.7 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1cc([N+](=O)[O-])c(O)c([N+](=O)[O-…
|
| ZINC2100022 ZINC | 1.000 | 284.4 Da LogP 3.86 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@]12C=CC(=O)C=C1CC[C@@H]1[C@@H]2CC[C@@]2(C)C…
|
| ZINC2159863 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H]1CC[C@@H]2[C@@H]3CCC4=CC(=O)CC[C@]4…
|
| ZINC238924247 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C@]4(C…
|
| ZINC242548813 ZINC | 1.000 | 284.4 Da LogP 3.86 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@]12C=CC(=O)C=C1CC[C@H]1[C@H]2CC[C@]2(C)C(=O…
|
| ZINC242648889 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C@]4(…
|
| ZINC253502176 ZINC | 1.000 | 284.4 Da LogP 3.86 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CCC4=CC(=O)C=C[C@]43C)[C@…
|
| ZINC3132721 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C@]4(C…
|
| ZINC3874744 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C@@]4…
|
| ZINC3881421 ZINC | 1.000 | 284.4 Da LogP 3.86 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@]12C=CC(=O)C=C1CC[C@@H]1[C@@H]2CC[C@]2(C)C(…
|
| ZINC4023563 ZINC | 1.000 | 284.4 Da LogP 3.86 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@@H](CCC4=CC(=O)C=C[C@@]43C)[…
|
| ZINC4023564 ZINC | 1.000 | 284.4 Da LogP 3.86 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@]12C=CC(=O)C=C1CC[C@@H]1[C@H]2CC[C@]2(C)C(=…
|
| ZINC4023565 ZINC | 1.000 | 284.4 Da LogP 3.86 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@]12C=CC(=O)C=C1CC[C@@H]1[C@@H]2CC[C@]2(C)C(…
|
| ZINC4081602 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[C@]4(C…
|
| ZINC4081603 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@@H]2[C@@H]3CCC4=CC(=O)CC[C@]4(…
|
| ZINC4428529 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[C@]4(C…
|
| ZINC4534007 ZINC | 1.000 | 284.4 Da LogP 3.86 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@@]12C=CC(=O)C=C1CC[C@H]1[C@H]2CC[C@@]2(C)C(…
|
| ZINC5260762 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C@@]4…
|
| ZINC58482279 ZINC | 1.000 | 284.4 Da LogP 3.86 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@]12C=CC(=O)C=C1CC[C@H]1[C@H]2CC[C@@]2(C)C(=…
|
| ZINC675050365 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H]1CC[C@H]2[C@H]3CCC4=CC(=O)CC[C@]4(C…
|
| ZINC8580672 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C@]4(…
|
| ZINC9212411 ZINC | 1.000 | 314.5 Da LogP 4.72 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@H]2[C@H]3CCC4=CC(=O)CC[C@]4(C)…
|
| ZINC69592773 ZINC | 0.843 | 344.4 Da LogP 2.29 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
C[C@]12CC(=O)[C@H]3[C@H](CCC4=CC(=O)C=C[C@@]43C…
|
| ZINC69592779 ZINC | 0.843 | 344.4 Da LogP 2.29 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
C[C@]12CC(=O)[C@H]3[C@@H](CCC4=CC(=O)C=C[C@@]43…
|
| ZINC1857666496 ZINC | 0.826 | 316.4 Da LogP 4.22 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](CCC4=CC(=O)CC[C@@]43C)[C@…
|
| ZINC245224552 ZINC | 0.826 | 316.4 Da LogP 4.22 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CCC4=CC(=O)CC[C@@]43C)[C@…
|
| ZINC253618173 ZINC | 0.826 | 316.4 Da LogP 4.22 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@]12CCC(=O)C=C1CC[C@H]1[C@H]2CC[C@@]2(C)[C@H…
|
| ZINC253618174 ZINC | 0.826 | 316.4 Da LogP 4.22 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@@]12CCC(=O)C=C1CC[C@H]1[C@H]2CC[C@]2(C)[C@H…
|
| ZINC253648944 ZINC | 0.826 | 316.4 Da LogP 4.22 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](CCC4=CC(=O)CC[C@@]43C)[C@…
|
| ZINC32911458 ZINC | 0.826 | 316.4 Da LogP 4.22 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](CCC4=CC(=O)CC[C@@]43C)[C@…
|
| ZINC3927796 ZINC | 0.826 | 316.4 Da LogP 4.22 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](CCC4=CC(=O)CC[C@@]43C)[C@…
|
| ZINC44830435 ZINC | 0.826 | 316.4 Da LogP 4.22 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@@]12CCC(=O)C=C1CC[C@H]1[C@H]2CC[C@@]2(C)[C@…
|
| ZINC4706032 ZINC | 0.826 | 300.4 Da LogP 4.33 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H]1CC[C@H]2[C@H]3CCC4=CC(=O)C[C@@]4(C…
|
| ZINC4706033 ZINC | 0.826 | 300.4 Da LogP 4.33 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@H]2[C@H]3CCC4=CC(=O)C[C@@]4(C)…
|
| ZINC4706034 ZINC | 0.826 | 300.4 Da LogP 4.33 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)C[C@@]4(…
|
| ZINC4706035 ZINC | 0.826 | 300.4 Da LogP 4.33 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)C[C@@]4(C…
|
| ZINC1857667003 ZINC | 0.792 | 330.5 Da LogP 4.31 TPSA 43.4 | ✓ Ro5 | ✓ Clean |
COC(=O)[C@@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[C@]4…
|
| ZINC2170217 ZINC | 0.792 | 200.1 Da LogP 0.91 TPSA 126.7 | ✓ Ro5 | Alert |
O=[N+]([O-])c1cc(O)c(O)c([N+](=O)[O-])c1
|
| ZINC21991584 ZINC | 0.792 | 330.5 Da LogP 4.31 TPSA 43.4 | ✓ Ro5 | ✓ Clean |
COC(=O)[C@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C@]4(…
|
| ZINC244882669 ZINC | 0.792 | 330.5 Da LogP 4.31 TPSA 43.4 | ✓ Ro5 | ✓ Clean |
COC(=O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C@]4…
|
| ZINC253498633 ZINC | 0.792 | 330.5 Da LogP 4.31 TPSA 43.4 | ✓ Ro5 | ✓ Clean |
COC(=O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C@@]…
|
| ZINC253618167 ZINC | 0.792 | 330.5 Da LogP 4.31 TPSA 43.4 | ✓ Ro5 | ✓ Clean |
COC(=O)[C@H]1CC[C@@H]2[C@@H]3CCC4=CC(=O)CC[C@]4…
|
| ZINC253618168 ZINC | 0.792 | 330.5 Da LogP 4.31 TPSA 43.4 | ✓ Ro5 | ✓ Clean |
COC(=O)[C@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C@]4(…
|
| ZINC3927798 ZINC | 0.792 | 330.5 Da LogP 4.31 TPSA 43.4 | ✓ Ro5 | ✓ Clean |
COC(=O)[C@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[C@]4(…
|
| ZINC68564159 ZINC | 0.792 | 366.2 Da LogP 2.40 TPSA 213.0 | ✓ Ro5 | ✓ Clean |
O=[N+]([O-])c1cc(-c2cc([N+](=O)[O-])cc([N+](=O)…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.