Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 2.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 79.694 Higher values support similarity to known essential genes.
- DEG E-value
- 0.0 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 91.21 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MYSAVDLIYLLLSGQVEGNMSVQNDKDNHYLLNNWRPENKAFWENKGQAIARRNLWISVACLLLAFCVWMLFSAVAVNLNKVGFHFTTDQLFLLTALPSLSGAILRVPYSFMVPLFGGRYWTVLSTVILIVPCIWLGVAIQNITTPFWVFIIIALLCGFAGANFASSMGNISFFFPKAKQGSALGVNGGLGNLGVSVMQMVAPAVIFLPLFTFLGVHGVTQPDGSTITLSNAALVWVPLLLLATVAAWFGMNDIAGSKASIRDQLPVLKRPHMWLLSLLYLATFGSFIGFSAGFAMLAKTQFPAVDILKLAFFGPFIGALARSFGGIISDRLGGVRVTLVNFVLMALFTGLLFLTLPGSGSGSFLAFYVVFMGLFLTAGLGSGSTFQMIAVIFRQLTIDSVKQRGGSDEEAQHEAVTDTAAALGFISAIGAIGGFFIPKAFGTSLAMTGSPVGAMKVFFVFYVVCVLVTWLVYGRRKPA
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Gene Ontology (GO)
10- GO:0015707 The directed movement of nitrite into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
- GO:0015112 Enables the transfer of nitrate ions (NO3-) from one side of a membrane to the other.
- GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
- GO:0015706 The directed movement of nitrate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0015113 Enables the transfer of nitrite (NO2-) ions from one side of a membrane to the other.
- GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0015291 Enables the transfer of a solute from one side of a membrane to the other, up its concentration gradient. The transporter binds the solute and undergoes a series of conformational changes. Transport works equally well in either direction and is driven by a chemiosmotic source of energy, not direct ATP coupling. Secondary active transporters include symporters and antiporters.
- GO:0042128 The nitrogen metabolic process that encompasses the uptake of nitrate from the environment and reduction to ammonia, and results in the incorporation of nitrogen derived from nitrate into cellular substances.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 121 | 141 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 55 | 79 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 332 | 354 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 360 | 364 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 364 | 386 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 474 | 479 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 197 | 219 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 147 | 169 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 420 | 437 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 452 | 474 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 20 | 479 | FunFam | G3DSA:1.20.1250.20:FF:000024 | Nitrite extrusion protein NarK |
| 33 | 478 | SUPERFAMILY | SSF103473 | MFS general substrate transporter |
| 33 | 478 | InterPro | IPR036259 | MFS transporter superfamily |
| 170 | 189 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 395 | 414 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 232 | 251 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 55 | 77 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 30 | 473 | PANTHER | PTHR23515 | HIGH-AFFINITY NITRATE TRANSPORTER 2.3 |
| 30 | 473 | InterPro | IPR044772 | Nitrate transporter |
| 20 | 479 | Gene3D | G3DSA:1.20.1250.20 | MFS general substrate transporter like domains |
| 20 | 479 | InterPro | IPR036259 | MFS transporter superfamily |
| 457 | 473 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 118 | 140 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 307 | 325 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 326 | 336 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 252 | 271 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 337 | 359 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 272 | 295 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 438 | 456 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 53 | 434 | NCBIfam | TIGR00886 | NarK family nitrate/nitrite MFS transporter |
| 53 | 434 | InterPro | IPR004737 | Nitrate transporter NarK/NarU-like |
| 273 | 295 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 365 | 394 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 142 | 146 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 233 | 251 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 80 | 90 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 214 | 232 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 110 | 120 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 415 | 437 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 147 | 169 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 91 | 109 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 55 | 471 | CDD | cd17341 | MFS_NRT2_like |
| 55 | 471 | InterPro | IPR044772 | Nitrate transporter |
| 190 | 213 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 296 | 306 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 54 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 62 | 438 | Pfam | PF07690 | Major Facilitator Superfamily |
| 62 | 438 | InterPro | IPR011701 | Major facilitator superfamily |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GTE2
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_04513
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1501016272 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC/C=C\CCCCCCC(=O)OC[C@H](O)CO
|
| ZINC1501016273 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCC/C=C\CCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC1501016315 ZINC | 1.000 | 314.5 Da LogP 3.75 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC1501016316 ZINC | 1.000 | 314.5 Da LogP 3.75 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCCC(=O)OC[C@H](O)CO
|
| ZINC2038077522 ZINC | 1.000 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC=CCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC2038077523 ZINC | 1.000 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC=CCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC221534416 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840893 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840894 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C/CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840895 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840896 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C/CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840901 ZINC | 1.000 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840902 ZINC | 1.000 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C/CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840903 ZINC | 1.000 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840904 ZINC | 1.000 | 356.5 Da LogP 4.92 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C/CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC64633397 ZINC | 1.000 | 226.4 Da LogP 4.55 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCC(=O)O
|
| ZINC725433050 ZINC | 1.000 | 342.5 Da LogP 4.53 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC725433052 ZINC | 1.000 | 342.5 Da LogP 4.53 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCCC(=O)OC[C@H](O)CO
|
| ZINC98208566 ZINC | 1.000 | 328.5 Da LogP 4.14 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C\CCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840885 ZINC | 0.943 | 300.4 Da LogP 3.36 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCC/C=C\CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC2053467566 ZINC | 0.919 | 354.5 Da LogP 4.70 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC=CCC=CCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC2053467567 ZINC | 0.919 | 354.5 Da LogP 4.70 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCC=CCC=CCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC29045599 ZINC | 0.919 | 354.5 Da LogP 4.70 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCC/C=C/C/C=C\CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC4557100 ZINC | 0.919 | 354.5 Da LogP 4.70 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCC/C=C\C/C=C\CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC4557101 ZINC | 0.919 | 354.5 Da LogP 4.70 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCC/C=C\C/C=C\CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC5819989 ZINC | 0.919 | 354.5 Da LogP 4.70 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCC/C=C/C/C=C/CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC5819990 ZINC | 0.919 | 354.5 Da LogP 4.70 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCC/C=C/C/C=C/CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC85425978 ZINC | 0.919 | 354.5 Da LogP 4.70 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCC/C=C\C/C=C/CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC1531062 ZINC | 0.917 | 226.4 Da LogP 4.55 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCC/C=C/CCCCCCCC(=O)O
|
| ZINC2504617 ZINC | 0.917 | 240.4 Da LogP 4.94 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCC/C=C/CCCCCCCCC(=O)O
|
| ZINC32786138 ZINC | 0.917 | 226.4 Da LogP 4.55 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC/C=C/CCCC(=O)O
|
| ZINC4529321 ZINC | 0.917 | 226.4 Da LogP 4.55 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCC/C=C\CCCCCCCC(=O)O
|
| ZINC5260769 ZINC | 0.917 | 240.4 Da LogP 4.94 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
CCCC/C=C\CCCCCCCCC(=O)O
|
| ZINC29045446 ZINC | 0.892 | 352.5 Da LogP 4.47 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCC/C=C\C/C=C\C/C=C\CCCCC(=O)OC[C@@H](O)CO
|
| ZINC13532428 ZINC | 0.829 | 372.5 Da LogP 3.89 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@@H](O)C/C=C\CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC13532431 ZINC | 0.829 | 372.5 Da LogP 3.89 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@@H](O)C/C=C/CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC13532435 ZINC | 0.829 | 372.5 Da LogP 3.89 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@H](O)C/C=C\CCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC13546140 ZINC | 0.829 | 372.5 Da LogP 3.89 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@@H](O)C/C=C\CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC13546141 ZINC | 0.829 | 372.5 Da LogP 3.89 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@@H](O)C/C=C/CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC2296552808 ZINC | 0.829 | 372.5 Da LogP 3.89 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@H](O)CC=CCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC2296552809 ZINC | 0.829 | 372.5 Da LogP 3.89 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC33832849 ZINC | 0.829 | 372.5 Da LogP 3.89 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@H](O)C/C=C\CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC35052109 ZINC | 0.829 | 372.5 Da LogP 3.89 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@H](O)C/C=C/CCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC4411072 ZINC | 0.829 | 372.5 Da LogP 3.89 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@H](O)CC=CCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC4411074 ZINC | 0.829 | 372.5 Da LogP 3.89 TPSA 87.0 | ✓ Ro5 | ✓ Clean |
CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC100503477 ZINC | 0.824 | 260.4 Da LogP 2.41 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840884 ZINC | 0.824 | 302.5 Da LogP 3.58 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC32840889 ZINC | 0.824 | 316.5 Da LogP 3.97 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCC(=O)OC[C@@H](O)CO
|
| ZINC32840890 ZINC | 0.824 | 316.5 Da LogP 3.97 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCC(=O)OC[C@H](O)CO
|
| ZINC77313111 ZINC | 0.824 | 344.5 Da LogP 4.75 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCCC(=O)OC[C@H](O)CO
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.