KpKP13 Protein target profile

AFG1-family ATPase protein

Accession: KP13_04578

Gene: AHE44453.1 3D evidence: AlphaFold DB model + ColabFold model UniProt W8VGK6
Export view
Length 338
Pocket druggability (P2Rank · AlphaFold DB model) 0.079
Functional annotation 1 EC 6 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Moderate predicted binding pocket FPocket selected-pocket score 0.54. This supports review but is not experimental validation. Structure available AlphaFold DB model + ColabFold model

Risks to review

Human similarity Top human hit identity: 46.774%. This target also has a predicted binding pocket (FPocket 0.54) — check the ligand evidence before deprioritizing on off-target risk alone. Microbiome similarity 8 of 4744 screened genomes (0.2%) have a significant similarity hit. This target also has a predicted binding pocket (FPocket 0.54) — check the ligand evidence before deprioritizing on off-target risk alone. Mixed conservation Core/accessory calls are not fully concordant. Weak second pocket-predictor signal P2Rank predicted binding-site probability 0.08.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
46.774 Lower values reduce human off-target concern.
Human E-value
9.61e-12
Gut microbiome similarity
0.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
86.22 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.079
Structure W8VGK6
Pocket Pocket 1
Druggability (FPocket) 0.535
Structure W8VGK6
Pocket Pocket 16
ColabFold model
P2Rank 0.618 · Pocket 1
FPocket 0.503 · Pocket 20
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 8 / 4744 genomes with a hit
Prevalence 0.2%

Sequence

Primary amino-acid sequence viewer.

MTADFRFTRVMAEQAARARLTLDDDQLSLIARLDALGQQLVSTTGRPQGVYVWGRTGRGKSFILDHFFASLPLAARRRVHFHHFFRELHQRLNAPGAPDLQTVMRQMTSGCRLLCFDEFHLHDPGDAMLIKALLEHLFQHGIVLLATSNYPPEMLLPNPLYHDRFLPSIALIRAHLTVVALNGEEDYRERHLSQDNAFCSGRMWVNPNAQQRQLYDLPSLPGEPVSLTVGYRTLLAAAASPALLHFTFTQLCQAATAVMDYLTLCESYAVWLLDEVPPLATVGPAAQQRFINVIDVLYEKQIRLLLVTRCDLETLVAGVELEDIQRTRSRLQQLPRAV

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0016887 Catalysis of the reaction: ATP + H2O = ADP + H+ phosphate. ATP hydrolysis is used in some reactions as an energy source, for example to catalyze a reaction or drive transport against a concentration gradient.
  • GO:0032153 The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0004096 Catalysis of the reaction: 2 H2O2 = O2 + 2 H2O.
  • GO:0051301 The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

10 records
Show feature table
Start End DB Term Name
43 317 PANTHER PTHR12169 ATPASE N2B
43 317 InterPro IPR005654 ATPase, AFG1-like
29 168 Gene3D G3DSA:3.40.50.300 -
29 168 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
43 335 Pfam PF03969 AFG1-like ATPase
43 335 InterPro IPR005654 ATPase, AFG1-like
12 334 NCBIfam NF040713 cell division protein ZapE
12 334 InterPro IPR005654 ATPase, AFG1-like
41 171 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
41 171 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.079
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.037
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.008
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.007
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.004
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #16
0.535
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_W8VGK6
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_04578
ColabFold — — full sequence — Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt W8VGK6