Protein target profile

KP13_05482

Hydantoin racemase

Genome: KpKP13 Gene: AHE44487.1 hyuE 3D evidence: Experimental + ColabFold model UniProt A6T9E8
Length 240
Pocket druggability 0.515
Direct ligand evidence 2 38 total records
Functional annotation 0 EC 2 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
53.556 Higher values support similarity to known essential genes.
DEG E-value
2.95e-84 Smaller values mean stronger essential-gene similarity.

Localization

Localization
Unknown

Structure confidence

ColabFold pLDDT
98.1 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

PDB experimental structure

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.515
Structure 3QVK
Pocket Pocket 4
P2Rank 0.4
Structure 3QVL
Pocket Pocket 1
ColabFold model
FPocket 0.49 · Pocket 7
P2Rank 0.422 · Pocket 1
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 51 / 4744 genomes with a hit
Prevalence 1.1%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MINPNTSLAMTETIGAAARAVAAPGTEILAVSPRAGVPSIEGHFDEAIAAVGVLEQIKAGREQGVDGHVIACFGDPGLLAARELAQGPVIGIAEAAMHMATMVATRFSIVTTLPRTLIIARHLLHQYGFHQHCAALHAIDLPVLALEDGSGLAQEKVRERCIRALKEDGSGAIVLGCGGMATLAQELTRELRVPVIDGVSAAVKMVESLVALGLATSKHGDLAFPEKKALSGQFQSLNPF

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0036361 OBSOLETE. Catalysis of the interconversion of the two enantiomers of a chiral amino acid or amino acid derivative.
  • GO:0006807 OBSOLETE. The chemical reactions and pathways involving organic or inorganic compounds that contain nitrogen.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

5 records
Show feature table
Start End DB Term Name
1 226 PANTHER PTHR28047 PROTEIN DCG1
1 234 FunFam G3DSA:3.40.50.12500:FF:000001 Putative hydantoin racemase
1 240 Gene3D G3DSA:3.40.50.12500 -
1 205 Pfam PF01177 Asp/Glu/Hydantoin racemase
1 205 InterPro IPR015942 Asp/Glu/hydantoin racemase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #4
0.515
Show in viewer
Surrounding area
Site 2 FPocket #11
0.222
Show in viewer
Surrounding area
All structural evidence 3 experimental · 1 predicted

Structural evidence

3 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 3QVJ
X-ray A Loaded
PDB 3QVK
X-ray A Viewing
PDB 3QVL
X-ray A Loaded
ColabFold KP13_05482
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

38 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 2 same-protein records
Transferred evidence 0 records from similar proteins
Structural ligands 2 2 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 36 similarity-based ZINC candidates
Best available ligand signal
2AL PDB co-crystal 156.1 Da · LogP -1.70 · TPSA 113.6 Open detail RCSB PDB
5HY PDB co-crystal Detail RCSB PDB
ZINC1738553 ZINC proposed compound · Tanimoto 0.576 Detail ZINC
ZINC264004 ZINC proposed compound · Tanimoto 0.576 Detail ZINC
ZINC264007 ZINC proposed compound · Tanimoto 0.576 Detail ZINC

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.

Show only:
Ligand Source crystal MW · LogP · TPSA Lipinski PAINS SMILES
2AL RCSB PDB 156.1 Da LogP -1.70 TPSA 113.6 ✓ Ro5 ✓ Clean C1(=O)C(=NC(=O)N1)NC(=O)N
5HY RCSB PDB 158.1 Da LogP -1.33 TPSA 95.5 ✓ Ro5 ✓ Clean C([C@@H]1C(=O)NC(=O)N1)C(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.