Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 0.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 96.74 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MQPNRVARILGIEKPVVQGPLSWLTDARLVAAVGNAGGLGVLGPNAGLTAATAVSTPEATAEKMREEIRKTKQLTEKPFGVNLIPTAENDIWTPAILPVIKEEGVKVVVYTGYGDGSLKPALFDELKAAGITIIYRDINPTPENSRRAEQAGADIIVATGFDEGGTLPGTALGTFTIVPLIVDAVQRVPVMAAGGITDARGARAVHALGAEGVFAGSVFISTIESRVPDSVKAKIVAANGLDLRLFRTLPDYYRALPGKLSDTLVAMDRAGASKAELAQAMGGLRGMRLGMLEGNTDEGYISVGAGIGNIHAITSVAEVVNQLAV
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
1- GO:0018580 Catalysis of the reaction: ethylnitronate + O2 = acetaldehyde + nitrite.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 12 | 248 | CDD | cd04730 | NPD_like |
| 12 | 248 | InterPro | IPR004136 | Nitronate monooxygenase |
| 7 | 323 | Pfam | PF03060 | Nitronate monooxygenase |
| 7 | 323 | InterPro | IPR004136 | Nitronate monooxygenase |
| 4 | 323 | PANTHER | PTHR32332 | 2-NITROPROPANE DIOXYGENASE |
| 2 | 325 | Gene3D | G3DSA:3.20.20.70 | Aldolase class I |
| 2 | 325 | InterPro | IPR013785 | Aldolase-type TIM barrel |
| 5 | 323 | SUPERFAMILY | SSF51412 | Inosine monophosphate dehydrogenase (IMPDH) |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GT14
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_05517
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| N1P RCSB PDB | A0A0M3KKW2 | 89.1 Da LogP 0.67 TPSA 43.1 | ✓ Ro5 | ✓ Clean |
CCC[N+](=O)[O-]
|
|
| NIE RCSB PDB | A0A0M3KKW1 | 75.1 Da LogP 0.28 TPSA 43.1 | ✓ Ro5 | ✓ Clean |
CC[N+](=O)[O-]
|
|
| NIS RCSB PDB | Q9I4V0 | 89.1 Da LogP 0.67 TPSA 43.1 | ✓ Ro5 | ✓ Clean |
CC(C)[N+](=O)[O-]
|
|
| TUI RCSB PDB | Q9FBC5 | 482.5 Da LogP 3.86 TPSA 142.1 | ✓ Ro5 | ✓ Clean |
c1ccnc(c1)Sc2cnc(s2)NC(=O)NCc3[nH]cc(n3)c4ccc(c…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL244805 ChEMBL | Q9FBC5 | 8.62 ~2.4 nM | 487.4 Da LogP 5.16 TPSA 95.6 | 1 viol. | ✓ Clean |
O=C(NCc1ncc(-c2ccc(Br)cc2)[nH]1)Nc1ncc(Sc2ccccn…
|
| CHEMBL392732 ChEMBL | Q9FBC5 | 8.43 ~3.7 nM | 477.4 Da LogP 5.71 TPSA 95.6 | 1 viol. | ✓ Clean |
O=C(NCc1ncc(-c2ccc(Cl)c(Cl)c2)[nH]1)Nc1ncc(Sc2c…
|
| CHEMBL390211 ChEMBL | Q9FBC5 | 8.35 ~4.5 nM | 721.7 Da LogP 7.02 TPSA 138.8 | 2 viol. | ✓ Clean |
Cc1c(Cc2c(Cl)cccc2Cl)c(=O)ccn1CCc1ccc(-c2c[nH]c…
|
| CHEMBL390894 ChEMBL | Q9FBC5 | 8.28 ~5.2 nM | 487.4 Da LogP 5.16 TPSA 95.6 | 1 viol. | ✓ Clean |
O=C(NCc1ncc(-c2cccc(Br)c2)[nH]1)Nc1ncc(Sc2ccccn…
|
| CHEMBL175157 ChEMBL | Q9FBC5 | 8.03 ~9.3 nM | 671.6 Da LogP 5.87 TPSA 138.8 | 2 viol. | ✓ Clean |
Cc1c(Cc2c(Cl)cccc2Cl)c(=O)ccn1CCc1ccc(-c2c[nH]c…
|
| CHEMBL244962 ChEMBL | Q9FBC5 | 7.80 ~15.8 nM | 702.7 Da LogP 8.01 TPSA 117.6 | 2 viol. | ✓ Clean |
Cc1c(Cc2c(Cl)cccc2Cl)c(=O)ccn1CCc1ccc(-c2c[nH]c…
|
| CHEMBL390895 ChEMBL | Q9FBC5 | 7.54 ~28.8 nM | 672.4 Da LogP 7.23 TPSA 104.7 | 2 viol. | ✓ Clean |
Cc1c(Cc2c(Cl)cccc2Cl)c(=O)ccn1CCc1ccc(-c2c[nH]c…
|
| CHEMBL242241 ChEMBL | Q9FBC5 | 7.47 ~33.9 nM | 504.5 Da LogP -0.47 TPSA 144.9 | 1 viol. | ✓ Clean |
O=C([O-])COc1ccc(-c2cnc(CNC(=O)Nc3ncc(Sc4ccccn4…
|
| CHEMBL235272 ChEMBL | Q9FBC5 | 7.43 ~37.2 nM | 450.5 Da LogP 4.11 TPSA 125.8 | ✓ Ro5 | ✓ Clean |
NC(=O)c1ccc(Sc2cnc(NC(=O)NCc3nc(-c4ccccc4)c[nH]…
|
| CHEMBL237639 ChEMBL | Q9FBC5 | 7.43 ~37.2 nM | 407.5 Da LogP 5.01 TPSA 82.7 | 1 viol. | ✓ Clean |
O=C(NCc1nc(-c2ccccc2)c[nH]1)Nc1ncc(Sc2ccccc2)s1
|
| CHEMBL244804 ChEMBL | Q9FBC5 | 7.38 ~41.7 nM | 408.5 Da LogP 4.40 TPSA 95.6 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ncc(-c2ccccc2)[nH]1)Nc1ncc(Sc2ccccn2)s1
|
| CHEMBL245045 ChEMBL | Q9FBC5 | 7.06 ~87.1 nM | 427.5 Da LogP 3.41 TPSA 116.8 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)NCc3nc(-c4ccccc4)c[nH]…
|
| CHEMBL235273 ChEMBL | Q9FBC5 | 7.01 ~97.7 nM | 451.5 Da LogP 4.70 TPSA 120.0 | ✓ Ro5 | ✓ Clean |
O=C(NCc1nc(-c2ccccc2)c[nH]1)Nc1ncc(Sc2ccc(C(=O)…
|
| CHEMBL237638 ChEMBL | Q9FBC5 | 6.42 ~380.2 nM | 375.5 Da LogP 4.52 TPSA 82.7 | ✓ Ro5 | ✓ Clean |
O=C(NCc1nc(-c2ccccc2)c[nH]1)Nc1ncc(-c2ccccc2)s1
|
| CHEMBL237837 ChEMBL | Q9FBC5 | 6.13 ~741.3 nM | 401.5 Da LogP 2.90 TPSA 116.8 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)NCc3nc4ccccc4[nH]3)sc2…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC12323660 ZINC | 0.703 | 432.6 Da LogP 3.45 TPSA 104.8 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)CSCc3nc4ccccc4[nH]3)sc…
|
| ZINC38489475 ZINC | 0.652 | 469.6 Da LogP 3.43 TPSA 108.0 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)C3CCN(Cc4nc5ccccc5[nH]…
|
| ZINC6144072 ZINC | 0.642 | 446.6 Da LogP 4.09 TPSA 104.8 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)CCCSc3nc4ccccc4[nH]3)s…
|
| ZINC8974189 ZINC | 0.610 | 347.4 Da LogP 3.34 TPSA 88.2 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)Nc3ccccc3)sc2c1
|
| ZINC97616521 ZINC | 0.607 | 329.4 Da LogP 1.90 TPSA 91.9 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1cccc(C(=O)NCc2nc3ccccc3[nH]2)c1
|
| ZINC69777982 ZINC | 0.593 | 291.4 Da LogP 2.70 TPSA 74.2 | ✓ Ro5 | ✓ Clean |
CC(C)(O)CNC(=O)Nc1ncc(-c2ccccc2)s1
|
| ZINC2658090 ZINC | 0.591 | 385.5 Da LogP 3.36 TPSA 91.9 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)Cc3c[nH]c4ccccc34)sc2c1
|
| ZINC4679732 ZINC | 0.587 | 372.5 Da LogP 3.74 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
C/C(=C\c1ccccc1)C(=O)Nc1nc2ccc(S(C)(=O)=O)cc2s1
|
| ZINC6700960 ZINC | 0.587 | 397.5 Da LogP 4.50 TPSA 88.2 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)Nc3cccc4ccccc34)sc2c1
|
| ZINC78603810 ZINC | 0.587 | 363.8 Da LogP 2.55 TPSA 91.9 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc(Cl)c(C(=O)NCc2nc3ccccc3[nH]2)c1
|
| ZINC72306134 ZINC | 0.586 | 345.5 Da LogP 3.63 TPSA 78.9 | ✓ Ro5 | ✓ Clean |
CNc1nc(CNC(=O)Nc2ncc(-c3ccccc3)s2)cs1
|
| ZINC13135072 ZINC | 0.585 | 422.5 Da LogP 4.55 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)Cc3ccc(-c4ccccc4)cc3)s…
|
| ZINC6648282 ZINC | 0.585 | 408.5 Da LogP 4.62 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)c3ccccc3-c3ccccc3)sc2c1
|
| ZINC2886225 ZINC | 0.581 | 361.4 Da LogP 3.65 TPSA 88.2 | ✓ Ro5 | ✓ Clean |
Cc1ccccc1NC(=O)Nc1nc2ccc(S(C)(=O)=O)cc2s1
|
| ZINC16678044 ZINC | 0.580 | 428.5 Da LogP 2.51 TPSA 121.9 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)CCc3nc4ccccc4c(=O)[nH]…
|
| ZINC3242454 ZINC | 0.578 | 408.5 Da LogP 4.62 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)c3ccc(-c4ccccc4)cc3)sc…
|
| ZINC9089909 ZINC | 0.576 | 332.4 Da LogP 2.95 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)c3ccccc3)sc2c1
|
| ZINC3264893 ZINC | 0.574 | 346.4 Da LogP 2.88 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)Cc3ccccc3)sc2c1
|
| ZINC18185404 ZINC | 0.574 | 423.5 Da LogP 4.32 TPSA 89.0 | ✓ Ro5 | ✓ Clean |
Cc1nc(-c2ccccc2)ccc1C(=O)Nc1nc2ccc(S(C)(=O)=O)c…
|
| ZINC953121 ZINC | 0.574 | 438.5 Da LogP 4.38 TPSA 85.4 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)COc3ccc(-c4ccccc4)cc3)…
|
| ZINC116241 ZINC | 0.571 | 270.3 Da LogP 1.66 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1nc2ccc(S(C)(=O)=O)cc2s1
|
| ZINC2772267 ZINC | 0.571 | 381.9 Da LogP 4.00 TPSA 88.2 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)Nc3ccccc3Cl)sc2c1
|
| ZINC2889978 ZINC | 0.571 | 365.4 Da LogP 3.48 TPSA 88.2 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)Nc3ccccc3F)sc2c1
|
| ZINC38212806 ZINC | 0.569 | 215.3 Da LogP 1.71 TPSA 57.8 | ✓ Ro5 | ✓ Clean |
CC(=O)NCc1nc(-c2ccccc2)c[nH]1
|
| ZINC27793338 ZINC | 0.567 | 399.5 Da LogP 3.61 TPSA 102.2 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)c3cc(-c4ccccc4)on3)sc2…
|
| ZINC96924932 ZINC | 0.567 | 399.5 Da LogP 2.79 TPSA 109.0 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)c3cc(=O)[nH]c4ccccc34)…
|
| ZINC55108187 ZINC | 0.565 | 288.3 Da LogP 2.04 TPSA 95.6 | ✓ Ro5 | ✓ Clean |
Cc1nsc(NC(=O)NCc2nc3ccccc3[nH]2)n1
|
| ZINC85557897 ZINC | 0.565 | 334.4 Da LogP 3.62 TPSA 70.7 | ✓ Ro5 | ✓ Clean |
O=C(NCc1nc(-c2ccccc2)c[nH]1)c1nc2ccccc2s1
|
| ZINC3549764 ZINC | 0.563 | 380.9 Da LogP 3.53 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)Cc3ccccc3Cl)sc2c1
|
| ZINC9599555 ZINC | 0.563 | 424.5 Da LogP 2.50 TPSA 110.3 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)CCS(=O)(=O)c3ccccc3)sc…
|
| ZINC4496643 ZINC | 0.561 | 378.5 Da LogP 3.43 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)CSc3ccccc3)sc2c1
|
| ZINC892887 ZINC | 0.561 | 362.4 Da LogP 2.72 TPSA 85.4 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)COc3ccccc3)sc2c1
|
| ZINC145449 ZINC | 0.559 | 284.4 Da LogP 2.05 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CCC(=O)Nc1nc2ccc(S(C)(=O)=O)cc2s1
|
| ZINC3248710 ZINC | 0.557 | 438.5 Da LogP 4.38 TPSA 85.4 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)COc3ccccc3-c3ccccc3)sc…
|
| ZINC20744499 ZINC | 0.556 | 460.6 Da LogP 2.81 TPSA 121.9 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)CSCc3nc4ccccc4c(=O)[nH…
|
| ZINC44902102 ZINC | 0.556 | 440.5 Da LogP 2.56 TPSA 111.0 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)Cn3nc(-c4ccccc4)ccc3=O…
|
| ZINC4731582 ZINC | 0.556 | 410.5 Da LogP 2.11 TPSA 110.3 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)CS(=O)(=O)c3ccccc3)sc2…
|
| ZINC8997096 ZINC | 0.556 | 436.6 Da LogP 4.86 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)CC(c3ccccc3)c3ccccc3)s…
|
| ZINC841201 ZINC | 0.554 | 458.3 Da LogP 3.56 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)c3ccccc3I)sc2c1
|
| ZINC917642 ZINC | 0.554 | 374.5 Da LogP 3.66 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)CCCc3ccccc3)sc2c1
|
| ZINC953115 ZINC | 0.554 | 434.5 Da LogP 4.88 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)/C(=C/c3ccccc3)c3ccccc…
|
| ZINC14462727 ZINC | 0.552 | 431.6 Da LogP 4.27 TPSA 89.0 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)CCCc3nc4ccccc4s3)sc2c1
|
| ZINC36354616 ZINC | 0.552 | 414.5 Da LogP 4.68 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)c3ccc(-c4ccccc4)s3)sc2…
|
| ZINC145665 ZINC | 0.550 | 310.4 Da LogP 2.60 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CC(C)=CC(=O)Nc1nc2ccc(S(C)(=O)=O)cc2s1
|
| ZINC74805157 ZINC | 0.550 | 352.5 Da LogP 3.32 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CC1(C)C(C(=O)Nc2nc3ccc(S(C)(=O)=O)cc3s2)C1(C)C
|
| ZINC2633847 ZINC | 0.549 | 474.6 Da LogP 4.80 TPSA 93.9 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)c3cc(-c4ccccc4)nn3-c3c…
|
| ZINC49027826 ZINC | 0.549 | 428.5 Da LogP 2.55 TPSA 121.0 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)CNC(=O)c3c[nH]c4ccccc3…
|
| ZINC252501964 ZINC | 0.548 | 344.4 Da LogP 2.58 TPSA 96.2 | ✓ Ro5 | ✓ Clean |
CN(C)c1noc(CNC(=O)Nc2ncc(-c3ccccc3)s2)n1
|
| ZINC2737213 ZINC | 0.548 | 422.5 Da LogP 4.47 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NC(=O)C(c3ccccc3)c3ccccc3)sc…
|
| ZINC62716546 ZINC | 0.548 | 318.4 Da LogP 3.31 TPSA 59.1 | ✓ Ro5 | ✓ Clean |
CS(=O)(=O)c1ccc2nc(NCc3ccccc3)sc2c1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.