Protein target profile

KP13_05519

HTH-type transcriptional regulator, LysR family

Genome: KpKP13 Gene: AHE44524.1 3D evidence: ColabFold model
Length 264
Pocket druggability 0.988
Direct ligand evidence 0 52 total records
Functional annotation 0 EC 2 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Localization

Localization
Cytoplasmic

Structure confidence

ColabFold pLDDT
90.1 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

ColabFold / curated model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.988
Structure CB_KP13_05519
Pocket Pocket 3
P2Rank 0.893
Structure CB_KP13_05519
Pocket Pocket 1
ColabFold model
FPocket 0.988 · Pocket 3
P2Rank 0.893 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 22 / 4744 genomes with a hit
Prevalence 0.5%

Sequence

Primary amino-acid sequence viewer.

MTKALQQLEQESGVRLLQRTTRRLYLTPEGEEFYRRSKPLLSQADDLLESFAPDRPIRGQLRVDMPIAFARLLVIPHLPDFYQAHPEVEIVLSSSDVRRDMLRDGLDCLLRVGDLEDGDYVARSLGEVALTTCASPGYLARYGAPATLEDLQSHLAVNWVNSSSRQIMPWRFQTPEGIRQIAIPGKLVLDNSEVFTAAGLAGLGMLQGMRFFLQPYIDSGQLVEVLPDFPAPRRPLSLLYPHRHLSHKVRVFADWLQGLVATLD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

14 records
Show feature table
Start End DB Term Name
2 79 SUPERFAMILY SSF46785 Winged helix DNA-binding domain
2 79 InterPro IPR036390 Winged helix DNA-binding domain superfamily
59 259 CDD cd08472 PBP2_CrgA_like_3
1 27 ProSiteProfiles PS50931 LysR-type HTH domain profile.
1 27 InterPro IPR000847 Transcription regulator HTH, LysR
2 31 Pfam PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
2 31 InterPro IPR000847 Transcription regulator HTH, LysR
56 257 Pfam PF03466 LysR substrate binding domain
56 257 InterPro IPR005119 LysR, substrate-binding
1 54 Gene3D G3DSA:1.10.10.10 -
1 54 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
56 262 SUPERFAMILY SSF53850 Periplasmic binding protein-like II
55 258 Gene3D G3DSA:3.40.190.290 -
3 257 PANTHER PTHR30537 HTH-TYPE TRANSCRIPTIONAL REGULATOR

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #3
0.988
Likely same site as P2Rank 1 4.4 Å 22 shared residues 96% of smaller site
Unusual size
Show in viewer
Surrounding area
Site 2 FPocket #6
0.251
Likely same site as P2Rank 2 4.8 Å 12 shared residues 92% of smaller site
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.893
Likely same site as FPocket 3 4.4 Å 22 shared residues 96% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.246
Likely same site as FPocket 6 4.8 Å 12 shared residues 92% of smaller site
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.088
Show in viewer
Surrounding area
All structural evidence 0 experimental · 1 predicted

Structural evidence

0 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
ColabFold KP13_05519
ColabFold full sequence Viewing

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
BEZ PDB via homolog 122.1 Da · LogP 1.38 · TPSA 37.3 Open detail RCSB PDB
MLI PDB via homolog Detail RCSB PDB
ZINC3269660 ZINC proposed compound · Tanimoto 0.824 Detail ZINC
ZINC2504355 ZINC proposed compound · Tanimoto 0.778 Detail ZINC
ZINC1672966 ZINC proposed compound · Tanimoto 0.688 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
BEZ RCSB PDB O68014 122.1 Da LogP 1.38 TPSA 37.3 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)O
MLI RCSB PDB O68014 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.