Protein target profile

KP13_05534

Ascorbate-specific permease IIC component ulaA

Genome: KpKP13 Gene: AHE44540.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GNI4
Length 424
Pocket druggability 0.854
Direct ligand evidence 0 53 total records
Functional annotation 0 EC 3 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
4.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
94.49 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.854
Structure A0A0H3GNI4
Pocket Pocket 1
P2Rank 0.882
Structure A0A0H3GNI4
Pocket Pocket 1
ColabFold model
FPocket 0.33 · Pocket 3
P2Rank 0.906 · Pocket 1
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 194 / 4744 genomes with a hit
Prevalence 4.1%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MEFNMLHFLIYDVLGTPAILVGLFSLIGLLLQKKGISDVISGTLKTIMGFVILTAGAGIIAYTLTIFSQLFEHSFHIQGVVPNTDAMAALAQKNYGTETATIMVLGMLINIALARLTPLKYIFLTGHHTLYMAAMLAVILSVGGLSGGWVVAIGAVILGAMMVISPAILQPFTRKITNTDDLALGHFGSIGYLLSALVGKIIGKGSPSIEEIKVPKSLNFLRDSSVAISLTMMILFLVLVLVAGKSFVEETLSAGQNFIIFAIIQSLTFAAGVYIILAGVRMVIAEIVPAFKGIADKLVKDAKPALDCPTVFPFAPNAVIVGFLASFVAGLVSMFLCPLFGLSVIVPGLVPHFFCGATAGVYGNITGGRRGAVVGAFAHGLLISFLPAILLPMMGDMGLGSTTFGDADFGIVGIVLGHIIAMFN

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0009401 The uptake and phosphorylation of specific carbohydrates from the extracellular environment; uptake and phosphorylation are coupled, making the PTS a link between the uptake and metabolism of sugars; phosphoenolpyruvate is the original phosphate donor; phosphoenolpyruvate passes the phosphate via a signal transduction pathway, to enzyme 1 (E1), which in turn passes it on to the histidine protein, HPr; the next step in the system involves sugar-specific membrane-bound complex, enzyme 2 (EII), which transports the sugar into the cell; it includes the sugar permease, which catalyzes the transport reactions; EII is usually divided into three different domains, EIIA, EIIB, and EIIC.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

37 records
Show feature table
Start End DB Term Name
311 333 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
343 365 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
256 277 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
226 248 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
43 64 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
372 395 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
396 406 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
130 163 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
258 280 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
32 42 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
10 32 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
372 394 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
3 422 PANTHER PTHR33843 ASCORBATE-SPECIFIC PTS SYSTEM EIIC COMPONENT
314 336 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
119 129 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
100 118 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 5 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
424 424 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
6 31 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
44 66 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
13 408 Pfam PF03611 PTS system sugar-specific permease component
13 408 InterPro IPR004703 Phosphotransferase system, sugar-specific permease component
337 341 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
204 223 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
366 371 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
65 99 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
164 182 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
121 143 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
407 423 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
404 423 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
183 203 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
95 114 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
224 244 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
245 255 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
147 169 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
342 365 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
278 313 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.854
Likely same site as P2Rank 1 2.7 Å 20 shared residues 100% of smaller site
Unusual size
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.882
Likely same site as FPocket 1 2.7 Å 20 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.138
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.055
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.044
Show in viewer
Surrounding area
Site 5 P2Rank #5
0.011
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GNI4
AlphaFold DB full sequence Viewing
ColabFold KP13_05534
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

53 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 3 records from similar proteins
Structural ligands 3 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
ASC PDB via homolog 176.1 Da · LogP -1.41 · TPSA 107.2 Open detail RCSB PDB
BNG PDB via homolog Detail RCSB PDB
TGL PDB via homolog Detail RCSB PDB
ZINC100050848 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC100056252 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ASC RCSB PDB P39301 176.1 Da LogP -1.41 TPSA 107.2 ✓ Ro5 ✓ Clean C([C@@H]([C@@H]1C(=C(C(=O)O1)O)O)O)O
BNG RCSB PDB P39301 306.4 Da LogP 0.55 TPSA 99.4 ✓ Ro5 ✓ Clean CCCCCCCCCO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1)CO…
TGL RCSB PDB P39301 891.5 Da LogP 18.77 TPSA 78.9 2 viol. ✓ Clean CCCCCCCCCCCCCCCCCC(=O)OCC(COC(=O)CCCCCCCCCCCCCC…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.