KpKP13 Protein target profile

putative fucose permease

Accession: KP13_05193

Gene: AHE44597.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A1L5HTD8
Export view
Length 444
Pocket druggability (P2Rank · AlphaFold DB model) 0.96
Functional annotation 0 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Independent pocket support: P2Rank + FPocket Both predictors report a high-scoring binding site (P2Rank 0.96, FPocket 0.96). Use the 3D pocket comparison to verify whether they identify the same site. No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Strong predicted binding pocket FPocket selected-pocket score 0.96. This is a computational pocket signal, not binding validation. Second pocket predictor agrees P2Rank predicted binding-site probability 0.96. Review the complete evidence below

Risks to review

Microbiome similarity 5 of 4744 screened genomes (0.1%) have a significant similarity hit. This target also has a predicted binding pocket (P2Rank 0.96) — check the ligand evidence before deprioritizing on off-target risk alone. Mixed conservation Core/accessory calls are not fully concordant.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
40.758 Higher values support similarity to known essential genes.
DEG E-value
2.87e-96 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
85.74 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.96
Structure A0A1L5HTD8
Pocket Pocket 1
Druggability (FPocket) 0.96
Structure A0A1L5HTD8
Pocket Pocket 3
ColabFold model
P2Rank 0.954 · Pocket 1
FPocket 0.711 · Pocket 2
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 5 / 4744 genomes with a hit
Prevalence 0.1%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A1L5HTD8

Sequence

Primary amino-acid sequence viewer.

MSTLITDKVDNAAVQKEKLDTSAYLPHTPWLQFLLVCCLFALWGMAGNLNDILIAQFKKGFDLTDTQTALVQSIFFLGYFFVALPAAALIKRFSYKAAIIIGLCLYALGCFLFVPAAQIMTYGAFLACLGVIACGLSFLETSANTYSSLLGPIQSSTQRINFSQIFNSLGVISGVLIGQLMVFGENDPSHEQLLAMPAAAADVARHQMVGQVVGPYLIIGSVLVVLALVFVFIKFPSCKGAPAQQQQLPTESMGPTLKRLFAIPRFRLGILSQFLYVGAQVGVWSFTIRFVQLVQQGTSEHSATYWLLASLVIYAVGKTVATWLMNRLNPAMLLGTFALAATALLLIAVFSGSMLAVYALILVSFCMAPCWPTNFGLVIKGMGKDTQTAGSIVVMSIIGGAVIPLVMGIISDMNGGNMQIAFIAPLLCFVYVAFYGFWCVRKGV

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

6
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0015535 Enables the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: fucose(out) + H+(out) = fucose(in) + H+(in).
  • GO:0015756 The process in which fucose is transported across a lipid bilayer, from one side of a membrane to the other. Fucose is 6-deoxygalactose and has two enantiomers, D-fucose and L-fucose.
  • GO:0015150 Enables the transfer of fucose from one side of a membrane to the other. Fucose is 6-deoxygalactose and has two enantiomers, D-fucose and L-fucose.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

51 records
Show feature table
Start End DB Term Name
303 325 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
97 116 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
251 443 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
251 443 InterPro IPR036259 MFS transporter superfamily
21 43 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
266 288 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
356 379 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
356 378 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
184 212 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
268 291 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
32 444 ProSiteProfiles PS50850 Major facilitator superfamily (MFS) profile.
32 444 InterPro IPR020846 Major facilitator superfamily domain
391 410 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
351 355 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
441 444 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
69 90 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
120 139 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
325 330 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
32 437 NCBIfam TIGR00885 L-fucose:H+ symporter permease
32 437 InterPro IPR005275 L-fucose-proton symporter FucP
330 352 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
292 302 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
68 90 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
30 438 PANTHER PTHR43702 L-FUCOSE-PROTON SYMPORTER
34 403 Pfam PF07690 Major Facilitator Superfamily
34 403 InterPro IPR011701 Major facilitator superfamily
50 68 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
18 442 SUPERFAMILY SSF103473 MFS general substrate transporter
18 442 InterPro IPR036259 MFS transporter superfamily
391 410 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
140 159 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
30 49 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
234 267 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
420 439 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
160 183 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
91 96 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
160 182 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
422 440 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
380 390 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
33 439 CDD cd17394 MFS_FucP_like
115 119 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
303 324 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 29 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
29 246 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
29 246 InterPro IPR036259 MFS transporter superfamily
120 139 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
211 233 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
213 233 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
411 421 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
331 350 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
97 114 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.96
Likely same site as FPocket 3 4.3 Å 22 shared residues 76% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.046
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.023
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.019
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.013
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #3
0.96 Unusual size
Likely same site as P2Rank 1 4.3 Å 22 shared residues 76% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A1L5HTD8
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_05193
ColabFold — — full sequence — Loaded