Protein target profile

KP13_05200

SMP-30/Gluconolaconase/LRE domain-containing protein

Genome: KpKP13 Gene: AHE44604.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GXG6
Export view
Length 292
Pocket druggability 0.546
Functional annotation 0 EC 3 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Moderate predicted binding pocket FPocket selected-pocket score 0.55. This supports review but is not experimental validation. Structure available AlphaFold DB model + ColabFold model

Risks to review

Human similarity Top human hit identity: 32.343%. This target also has a predicted binding pocket (FPocket 0.55) — check the ligand evidence before deprioritizing on off-target risk alone. Microbiome similarity 10 of 4744 screened genomes (0.2%) have a significant similarity hit. This target also has a predicted binding pocket (FPocket 0.55) — check the ligand evidence before deprioritizing on off-target risk alone. Weak second pocket-predictor signal P2Rank predicted binding-site probability 0.49.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
32.343 Lower values reduce human off-target concern.
Human E-value
1.75e-39
Gut microbiome similarity
0.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Localization

Localization
Unknown

Structure confidence

ColabFold pLDDT
96.88 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.546
Structure A0A0H3GXG6
Pocket Pocket 6
P2Rank 0.49
Structure A0A0H3GXG6
Pocket Pocket 1
ColabFold model
FPocket 0.596 · Pocket 2
P2Rank 0.482 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 10 / 4744 genomes with a hit
Prevalence 0.2%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GXG6

Sequence

Primary amino-acid sequence viewer.

MRIEVLLDLKTRLGESPVWDVEQQRLWWVDSLDGRLFACNAQGGAIKSWDVRQKIGSFALRQNGEGAVVALQNGVHLLDFASGELTLLHHPEADRPFNRLNDGKVDRQGRFLFGSMDMREEEPSGALYRLDADLSLHVLKKDIIVSNAPCWSPSGETFYFADTWTGEICAWDYNTATGDLSGERVFCHVDRSEGGAADGATVDSEGYLWNALVYAGKLVRYTPEGKVDRIIEMPVKKVTSVMFGGENLDVLYVTSMAQPPLPRFPEDNQLRGSLFAIYDLGATGVAERRFAG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0005509 Binding to a calcium ion (Ca2+).
  • GO:0004341 Catalysis of the reaction: D-glucono-1,5-lactone + H2O = D-gluconate.
  • GO:0019853 The chemical reactions and pathways resulting in the formation of L-ascorbic acid; L-ascorbic acid ionizes to give L-ascorbate, (2R)-2-[(1S)-1,2-dihydroxyethyl]-4-hydroxy-5-oxo-2,5-dihydrofuran-3-olate, which is required as a cofactor in the oxidation of prolyl residues to hydroxyprolyl, and other reactions.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
196 213 PRINTS PR01790 Senescence marker protein-30 (SMP30) family signature
196 213 InterPro IPR005511 Senescence marker protein-30 (SMP-30)
14 31 PRINTS PR01790 Senescence marker protein-30 (SMP30) family signature
14 31 InterPro IPR005511 Senescence marker protein-30 (SMP-30)
238 256 PRINTS PR01790 Senescence marker protein-30 (SMP30) family signature
238 256 InterPro IPR005511 Senescence marker protein-30 (SMP-30)
132 154 PRINTS PR01790 Senescence marker protein-30 (SMP30) family signature
132 154 InterPro IPR005511 Senescence marker protein-30 (SMP-30)
155 175 PRINTS PR01790 Senescence marker protein-30 (SMP30) family signature
155 175 InterPro IPR005511 Senescence marker protein-30 (SMP-30)
91 112 PRINTS PR01790 Senescence marker protein-30 (SMP30) family signature
91 112 InterPro IPR005511 Senescence marker protein-30 (SMP-30)
1 292 PANTHER PTHR10907 REGUCALCIN
13 256 Pfam PF08450 SMP-30/Gluconolactonase/LRE-like region
13 256 InterPro IPR013658 SMP-30/Gluconolactonase/LRE-like region
1 292 Gene3D G3DSA:2.120.10.30 -
1 292 InterPro IPR011042 Six-bladed beta-propeller, TolB-like
6 289 SUPERFAMILY SSF63829 Calcium-dependent phosphotriesterase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #6
0.546
Show in viewer
Surrounding area
Site 2 FPocket #2
0.485
Likely same site as P2Rank 4 7.8 Å 2 shared residues 25% of smaller site
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.49
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.097
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.001
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.001
Likely same site as FPocket 2 7.8 Å 2 shared residues 25% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:198-198 Proton donor/acceptor
UniProt: Binding site:101-101
UniProt: Binding site:147-147
UniProt: Binding site:15-15
UniProt: Binding site:198-198
UniProt: Binding site:99-99
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GXG6
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_05200
ColabFold — — full sequence — Loaded