Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 0.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 86.43 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKLSSGSITTGRTSGLLTLAIGALFYSSGSIARPDLQPLGPNVADKGSAFYHFTQRQYDSADGERHYRVWTAVPDKAPPAAGYPVLYMLDGNAVMDKLDDAFLQQLFAGSPPVIVAIGYQTALPFDTAARAWDYTPPLKTHEPRAGKPALPPRKTGGNDAFRQLLTETMVPQTEANLKIDPHQRAIWGHSYGGLFVLDAWRKASPFGIYYSASPSLGQALQSPLQASQSLDAVRFRGKSLYLLEGDGKARGEPSGHEASLEVLRQTQQQLASKGLTVAFWRYPGLTHGQMFEVSLRSALLHLSGQAALAHQ
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Gene Ontology (GO)
1- GO:0016788 Catalysis of the hydrolysis of any ester bond.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 25 | 32 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 42 | 303 | SUPERFAMILY | SSF53474 | alpha/beta-Hydrolases |
| 42 | 303 | InterPro | IPR029058 | Alpha/Beta hydrolase fold |
| 13 | 24 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 33 | 311 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 23 | 306 | PANTHER | PTHR40841 | SIDEROPHORE TRIACETYLFUSARININE C ESTERASE |
| 1 | 12 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 64 | 301 | Pfam | PF00756 | Putative esterase |
| 64 | 301 | InterPro | IPR000801 | Esterase-like |
| 41 | 310 | Gene3D | G3DSA:3.40.50.1820 | alpha/beta hydrolase |
| 41 | 310 | InterPro | IPR029058 | Alpha/Beta hydrolase fold |
| 1 | 32 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A2V3K4X6
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_05213
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 8SW RCSB PDB | Q9I0F2 | 692.6 Da LogP -1.77 TPSA 296.0 | 3 viol. | Alert |
C#CCNC(=O)C(CNC(=O)C(CNC(=O)CNC(=O)c1cccc(c1O)O…
|
|
| DBS RCSB PDB | Q9I0F2 | 241.2 Da LogP -0.73 TPSA 127.1 | ✓ Ro5 | Alert |
c1cc(c(c(c1)O)O)C(=O)N[C@@H](CO)C(=O)O
|
|
| DFP RCSB PDB | Q6KD95 | 166.2 Da LogP 2.23 TPSA 35.5 | ✓ Ro5 | ✓ Clean |
CC(C)OP(=O)OC(C)C
|
|
| EB4 RCSB PDB | Q9I0F2 | 669.6 Da LogP -0.74 TPSA 287.6 | 3 viol. | Alert |
c1cc(c(c(c1)O)O)C(=O)N[C@H]2COC(=O)[C@H](COC(=O…
|
|
| FN8 RCSB PDB | Q4WF29 | 389.4 Da LogP 0.42 TPSA 139.6 | ✓ Ro5 | ✓ Clean |
CCC(=O)N(CCC[C@@H]([C@@H](O)OCC/C(=C\C(=O)N(C)O…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC901977 ZINC | 1.000 | 241.2 Da LogP -0.73 TPSA 127.1 | ✓ Ro5 | Alert |
O=C(N[C@@H](CO)C(=O)O)c1cccc(O)c1O
|
| ZINC14696227 ZINC | 0.788 | 225.2 Da LogP -0.43 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
O=C(N[C@H](CO)C(=O)O)c1ccccc1O
|
| ZINC142623932 ZINC | 0.763 | 464.4 Da LogP -0.97 TPSA 222.9 | 1 viol. | Alert |
O=C(N[C@@H](COC(=O)[C@H](CO)NC(=O)c1cccc(O)c1O)…
|
| ZINC35466170 ZINC | 0.703 | 255.2 Da LogP -0.64 TPSA 116.1 | ✓ Ro5 | Alert |
COC(=O)[C@@H](CO)NC(=O)c1cccc(O)c1O
|
| ZINC35466172 ZINC | 0.703 | 255.2 Da LogP -0.64 TPSA 116.1 | ✓ Ro5 | Alert |
COC(=O)[C@H](CO)NC(=O)c1cccc(O)c1O
|
| ZINC6091714 ZINC | 0.698 | 369.4 Da LogP -1.11 TPSA 182.2 | 1 viol. | Alert |
NCCCC[C@@H](NC(=O)c1cccc(O)c1O)C(=O)N[C@@H](CO)…
|
| ZINC3650087 ZINC | 0.634 | 418.4 Da LogP 1.29 TPSA 176.4 | 1 viol. | Alert |
O=C(NCCCC[C@H](NC(=O)c1cccc(O)c1O)C(=O)O)c1cccc…
|
| ZINC398718801 ZINC | 0.625 | 241.2 Da LogP 0.31 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
Cc1c(F)cccc1C(=O)N[C@@H](CO)C(=O)O
|
| ZINC199515761 ZINC | 0.605 | 446.4 Da LogP 0.18 TPSA 202.7 | 1 viol. | Alert |
C=C(NC(=O)c1cccc(O)c1O)C(=O)OC[C@H](NC(=O)c1ccc…
|
| ZINC164352 ZINC | 0.600 | 209.2 Da LogP -0.14 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(N[C@@H](CO)C(=O)O)c1ccccc1
|
| ZINC164355 ZINC | 0.600 | 209.2 Da LogP -0.14 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(N[C@H](CO)C(=O)O)c1ccccc1
|
| ZINC51440864 ZINC | 0.596 | 232.2 Da LogP -0.13 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
C#CCNC(=O)CNC(=O)c1ccccc1O
|
| ZINC4800918 ZINC | 0.595 | 253.2 Da LogP 0.05 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
O=C(O)C[C@H](NC(=O)c1ccccc1O)C(=O)O
|
| ZINC119265 ZINC | 0.585 | 275.2 Da LogP 0.46 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
O=C(N[C@@H](CO)C(=O)O)c1ccccc1OC(F)F
|
| ZINC119267 ZINC | 0.585 | 275.2 Da LogP 0.46 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
O=C(N[C@H](CO)C(=O)O)c1ccccc1OC(F)F
|
| ZINC1610701673 ZINC | 0.585 | 313.4 Da LogP 1.65 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(N[C@@H](CO)C(=O)O)c1ccccc1CCc1ccccc1
|
| ZINC1875323734 ZINC | 0.585 | 313.4 Da LogP 1.65 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(N[C@H](CO)C(=O)O)c1ccccc1CCc1ccccc1
|
| ZINC340735 ZINC | 0.585 | 267.3 Da LogP 0.65 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
CC(C)Oc1ccccc1C(=O)N[C@@H](CO)C(=O)O
|
| ZINC340737 ZINC | 0.585 | 267.3 Da LogP 0.65 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
CC(C)Oc1ccccc1C(=O)N[C@H](CO)C(=O)O
|
| ZINC340731 ZINC | 0.571 | 253.3 Da LogP 0.26 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
CCOc1ccccc1C(=O)N[C@@H](CO)C(=O)O
|
| ZINC340733 ZINC | 0.571 | 253.3 Da LogP 0.26 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
CCOc1ccccc1C(=O)N[C@H](CO)C(=O)O
|
| ZINC1772656721 ZINC | 0.558 | 233.2 Da LogP 0.60 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
C=C1C(=O)OC[C@H]1NC(=O)c1ccccc1O
|
| ZINC8378807 ZINC | 0.553 | 243.6 Da LogP 0.52 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(N[C@@H](CO)C(=O)O)c1ccc(Cl)cc1
|
| ZINC2173017 ZINC | 0.550 | 267.2 Da LogP 0.44 TPSA 123.9 | ✓ Ro5 | ✓ Clean |
O=C(O)CC[C@H](NC(=O)c1ccccc1O)C(=O)O
|
| ZINC1601568943 ZINC | 0.545 | 321.3 Da LogP 2.10 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(N[C@H](Cc1ccc(F)cc1)C(=O)O)c1cccc(F)c1O
|
| ZINC2568425 ZINC | 0.545 | 267.3 Da LogP 0.65 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
CCCOc1ccccc1C(=O)N[C@H](CO)C(=O)O
|
| ZINC3068343 ZINC | 0.545 | 267.3 Da LogP 0.65 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
CCCOc1ccccc1C(=O)N[C@@H](CO)C(=O)O
|
| ZINC340739 ZINC | 0.545 | 281.3 Da LogP 0.90 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
CC(C)COc1ccccc1C(=O)N[C@@H](CO)C(=O)O
|
| ZINC340741 ZINC | 0.545 | 281.3 Da LogP 0.90 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
CC(C)COc1ccccc1C(=O)N[C@H](CO)C(=O)O
|
| ZINC19489044 ZINC | 0.537 | 288.1 Da LogP 0.62 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(N[C@H](CO)C(=O)O)c1cccc(Br)c1
|
| ZINC19489045 ZINC | 0.537 | 288.1 Da LogP 0.62 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(N[C@@H](CO)C(=O)O)c1cccc(Br)c1
|
| ZINC401328 ZINC | 0.537 | 243.6 Da LogP 0.52 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(N[C@@H](CO)C(=O)O)c1cccc(Cl)c1
|
| ZINC19515351 ZINC | 0.525 | 223.2 Da LogP 0.90 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
Cc1cccc(C(=O)N[C@H](C)C(=O)O)c1O
|
| ZINC122930455 ZINC | 0.524 | 228.2 Da LogP -0.60 TPSA 99.5 | ✓ Ro5 | ✓ Clean |
O=C(N[C@@H](CO)C(=O)O)c1cccc(F)n1
|
| ZINC193163770 ZINC | 0.524 | 269.3 Da LogP 2.00 TPSA 69.6 | ✓ Ro5 | Alert |
O=C(NC1Cc2ccccc2C1)c1cccc(O)c1O
|
| ZINC4102415 ZINC | 0.523 | 404.4 Da LogP 1.20 TPSA 159.3 | 1 viol. | Alert |
O=C(NCCCC[C@@H](CO)NC(=O)c1cccc(O)c1O)c1cccc(O)…
|
| ZINC194482295 ZINC | 0.519 | 264.7 Da LogP 1.13 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
C#CCNC(=O)CNC(=O)c1cccc(Cl)c1C
|
| ZINC21957522 ZINC | 0.513 | 227.2 Da LogP 0.00 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(N[C@H](CO)C(=O)O)c1ccc(F)cc1
|
| ZINC21957525 ZINC | 0.513 | 227.2 Da LogP 0.00 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=C(N[C@@H](CO)C(=O)O)c1ccc(F)cc1
|
| ZINC226795611 ZINC | 0.513 | 424.4 Da LogP -0.22 TPSA 207.4 | 1 viol. | ✓ Clean |
O=C(O)CC[C@H](NC(=O)c1ccccc1C(=O)N[C@H](CCC(=O)…
|
| ZINC226795619 ZINC | 0.513 | 424.4 Da LogP -0.22 TPSA 207.4 | 1 viol. | ✓ Clean |
O=C(O)CC[C@H](NC(=O)c1ccccc1C(=O)N[C@@H](CCC(=O…
|
| ZINC226795624 ZINC | 0.513 | 424.4 Da LogP -0.22 TPSA 207.4 | 1 viol. | ✓ Clean |
O=C(O)CC[C@@H](NC(=O)c1ccccc1C(=O)N[C@H](CCC(=O…
|
| ZINC4611493 ZINC | 0.513 | 210.2 Da LogP -0.74 TPSA 99.5 | ✓ Ro5 | ✓ Clean |
O=C(N[C@@H](CO)C(=O)O)c1ccncc1
|
| ZINC4611494 ZINC | 0.513 | 210.2 Da LogP -0.74 TPSA 99.5 | ✓ Ro5 | ✓ Clean |
O=C(N[C@H](CO)C(=O)O)c1ccncc1
|
| ZINC22221666 ZINC | 0.500 | 254.2 Da LogP -0.23 TPSA 129.8 | ✓ Ro5 | ✓ Clean |
O=C(N[C@H](CO)C(=O)O)c1cccc([N+](=O)[O-])c1
|
| ZINC22221668 ZINC | 0.500 | 254.2 Da LogP -0.23 TPSA 129.8 | ✓ Ro5 | ✓ Clean |
O=C(N[C@@H](CO)C(=O)O)c1cccc([N+](=O)[O-])c1
|
| ZINC22761347 ZINC | 0.500 | 286.4 Da LogP 1.89 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
C#CCNC(=O)[C@@H](CC(C)C)NC(=O)c1ccccc1C
|
| ZINC22761350 ZINC | 0.500 | 286.4 Da LogP 1.89 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
C#CCNC(=O)[C@H](CC(C)C)NC(=O)c1ccccc1C
|
| ZINC490726 ZINC | 0.500 | 210.2 Da LogP -0.74 TPSA 99.5 | ✓ Ro5 | ✓ Clean |
O=C(N[C@H](CO)C(=O)O)c1cccnc1
|
| ZINC574217561 ZINC | 0.500 | 307.2 Da LogP 0.67 TPSA 95.9 | ✓ Ro5 | ✓ Clean |
COC(=O)[C@H](CO)NC(=O)c1cccc(C(F)(F)F)c1O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.