Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 3.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 90.06 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFKAGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGTGLHPSFAQALETSMVCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENSDLLAQLAGQARNVA
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
8- GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
- GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
- GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0032993 A macromolecular complex containing both protein and DNA molecules.
- GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
- GO:0001216 A DNA-binding transcription factor activity that activates or increases transcription of specific gene sets.
- GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 34 | 144 | CDD | cd00038 | CAP_ED |
| 34 | 144 | InterPro | IPR000595 | Cyclic nucleotide-binding domain |
| 51 | 132 | Pfam | PF00027 | Cyclic nucleotide-binding domain |
| 51 | 132 | InterPro | IPR000595 | Cyclic nucleotide-binding domain |
| 209 | 224 | PRINTS | PR00034 | CRP bacterial regulatory protein HTH signature |
| 209 | 224 | InterPro | IPR012318 | Crp-type HTH domain |
| 193 | 209 | PRINTS | PR00034 | CRP bacterial regulatory protein HTH signature |
| 193 | 209 | InterPro | IPR012318 | Crp-type HTH domain |
| 165 | 250 | Gene3D | G3DSA:1.10.10.10 | - |
| 165 | 250 | InterPro | IPR036388 | Winged helix-like DNA-binding domain superfamily |
| 30 | 151 | SMART | SM00100 | cnmp_10 |
| 30 | 151 | InterPro | IPR000595 | Cyclic nucleotide-binding domain |
| 50 | 244 | PANTHER | PTHR24567 | CRP FAMILY TRANSCRIPTIONAL REGULATORY PROTEIN |
| 187 | 235 | SMART | SM00419 | crpmeuga4 |
| 187 | 235 | InterPro | IPR012318 | Crp-type HTH domain |
| 193 | 224 | Pfam | PF00325 | Bacterial regulatory proteins, crp family |
| 193 | 224 | InterPro | IPR012318 | Crp-type HTH domain |
| 23 | 162 | SUPERFAMILY | SSF51206 | cAMP-binding domain-like |
| 23 | 162 | InterPro | IPR018490 | Cyclic nucleotide-binding domain superfamily |
| 30 | 104 | ProSiteProfiles | PS50042 | cAMP/cGMP binding motif profile. |
| 30 | 104 | InterPro | IPR000595 | Cyclic nucleotide-binding domain |
| 195 | 218 | ProSitePatterns | PS00042 | Crp-type HTH domain signature. |
| 195 | 218 | InterPro | IPR018335 | Transcription regulator HTH, Crp-type, conserved site |
| 19 | 164 | Gene3D | G3DSA:2.60.120.10 | Jelly Rolls |
| 19 | 164 | InterPro | IPR014710 | RmlC-like jelly roll fold |
| 166 | 233 | CDD | cd00092 | HTH_CRP |
| 19 | 164 | FunFam | G3DSA:2.60.120.10:FF:000004 | Fumarate/nitrate reduction transcriptional regulator Fnr |
| 164 | 237 | ProSiteProfiles | PS51063 | Crp-type HTH domain profile. |
| 164 | 237 | InterPro | IPR012318 | Crp-type HTH domain |
| 165 | 245 | FunFam | G3DSA:1.10.10.10:FF:000028 | Fumarate/nitrate reduction transcriptional regulator Fnr |
| 165 | 244 | SUPERFAMILY | SSF46785 | Winged helix DNA-binding domain |
| 165 | 244 | InterPro | IPR036390 | Winged helix DNA-binding domain superfamily |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GMU3
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_05031
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 2FT RCSB PDB | P0A4U6 | 168.1 Da LogP 0.57 TPSA 74.6 | ✓ Ro5 | ✓ Clean |
C(CC(C(=O)O)(F)F)C(=O)O
|
|
| AKG RCSB PDB | P0A4U6 | 146.1 Da LogP -0.50 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
C(CC(=O)O)C(=O)C(=O)O
|
|
| BTB RCSB PDB | P29283 | 209.2 Da LogP -3.01 TPSA 104.4 | ✓ Ro5 | ✓ Clean |
C(CO)N(CCO)C(CO)(CO)CO
|
|
| FES RCSB PDB | Q70ET4 | 175.8 Da LogP 1.29 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
S1[Fe]S[Fe]1
|
|
| PCG RCSB PDB | C3SQJ7 | 345.2 Da LogP -1.52 TPSA 174.8 | ✓ Ro5 | ✓ Clean |
c1nc2c(n1[C@H]3[C@@H]([C@H]4C(O3)CO[P@](=O)(O4)…
|
|
| SP1 RCSB PDB | P0ACJ8 | 345.3 Da LogP -0.70 TPSA 137.8 | ✓ Ro5 | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@H]4[C@H](O3)C…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC12501894 ZINC | 1.000 | 345.2 Da LogP -1.52 TPSA 174.8 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@@H]3CO[P@](=O)(O)O[C@@H]…
|
| ZINC1615342 ZINC | 1.000 | 209.2 Da LogP -3.01 TPSA 104.4 | ✓ Ro5 | ✓ Clean |
OCCN(CCO)C(CO)(CO)CO
|
| ZINC33494013 ZINC | 1.000 | 345.2 Da LogP -1.52 TPSA 174.8 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@@H]3CO[P@](=O)(O)O[C@@H]…
|
| ZINC4095501 ZINC | 1.000 | 345.2 Da LogP -1.52 TPSA 174.8 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@@H]3CO[P@](=O)(O)O[C@H]3…
|
| ZINC88465990 ZINC | 1.000 | 345.2 Da LogP -1.52 TPSA 174.8 | ✓ Ro5 | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@@H]3CO[P@@](=O)(O)O[C@H]…
|
| ZINC4095503 ZINC | 0.746 | 330.2 Da LogP -1.11 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@@H]2CO[P@](=O)(O)O…
|
| ZINC4533542 ZINC | 0.746 | 330.2 Da LogP -1.11 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@H]2CO[P@](=O)(O)O[C…
|
| ZINC4533545 ZINC | 0.746 | 330.2 Da LogP -1.11 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@H]2CO[P@](=O)(O)O[C…
|
| ZINC13515981 ZINC | 0.701 | 415.3 Da LogP -0.37 TPSA 177.9 | ✓ Ro5 | ✓ Clean |
CCCC(=O)Nc1nc2c(ncn2[C@@H]2O[C@@H]3CO[P@](=O)(O…
|
| ZINC25757995 ZINC | 0.689 | 346.2 Da LogP -1.81 TPSA 168.8 | ✓ Ro5 | ✓ Clean |
O=c1[nH]c(=O)c2ncn([C@H]3O[C@H]4CO[P@](=O)(O)O[…
|
| ZINC25757999 ZINC | 0.689 | 346.2 Da LogP -1.81 TPSA 168.8 | ✓ Ro5 | ✓ Clean |
O=c1[nH]c(=O)c2ncn([C@H]3O[C@H]4CO[P@@](=O)(O)O…
|
| ZINC12502230 ZINC | 0.672 | 329.2 Da LogP -0.82 TPSA 154.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H]2CO[P@](=O)(O)O[C@@…
|
| ZINC3581269 ZINC | 0.672 | 329.2 Da LogP -0.82 TPSA 154.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H]2CO[P@](=O)(O)O[C@H…
|
| ZINC3869448 ZINC | 0.672 | 329.2 Da LogP -0.82 TPSA 154.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H]2CO[P@](=O)(O)O[C@@H]…
|
| ZINC3869449 ZINC | 0.672 | 329.2 Da LogP -0.82 TPSA 154.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H]2CO[P@](=O)(O)O[C@@H…
|
| ZINC3869450 ZINC | 0.672 | 329.2 Da LogP -0.82 TPSA 154.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H]2CO[P@](=O)(O)O[C@@H]…
|
| ZINC3869451 ZINC | 0.672 | 329.2 Da LogP -0.82 TPSA 154.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H]2CO[P@](=O)(O)O[C@@H…
|
| ZINC3873977 ZINC | 0.672 | 329.2 Da LogP -0.82 TPSA 154.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H]2CO[P@](=O)(O)O[C@H…
|
| ZINC4245698 ZINC | 0.672 | 329.2 Da LogP -0.82 TPSA 154.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H]2CO[P@](=O)(O)O[C@@…
|
| ZINC5080458 ZINC | 0.656 | 323.3 Da LogP -0.89 TPSA 137.5 | ✓ Ro5 | ✓ Clean |
CC1(C)OC[C@H]2O[C@@H](n3cnc4c(=O)[nH]c(N)nc43)[…
|
| ZINC5080460 ZINC | 0.656 | 323.3 Da LogP -0.89 TPSA 137.5 | ✓ Ro5 | ✓ Clean |
CC1(C)OC[C@@H]2O[C@@H](n3cnc4c(=O)[nH]c(N)nc43)…
|
| ZINC5080462 ZINC | 0.656 | 323.3 Da LogP -0.89 TPSA 137.5 | ✓ Ro5 | ✓ Clean |
CC1(C)OC[C@H]2O[C@@H](n3cnc4c(=O)[nH]c(N)nc43)[…
|
| ZINC5080463 ZINC | 0.656 | 323.3 Da LogP -0.89 TPSA 137.5 | ✓ Ro5 | ✓ Clean |
CC1(C)OC[C@@H]2O[C@@H](n3cnc4c(=O)[nH]c(N)nc43)…
|
| ZINC38580931 ZINC | 0.651 | 345.2 Da LogP -1.58 TPSA 168.9 | ✓ Ro5 | ✓ Clean |
Nc1c2ncn([C@@H]3O[C@@H]4CO[P@](=O)(O)O[C@H]4[C@…
|
| ZINC25757988 ZINC | 0.641 | 346.2 Da LogP -1.40 TPSA 169.0 | ✓ Ro5 | ✓ Clean |
O=c1nc(O)[nH]c2c1ncn2[C@H]1O[C@H]2CO[P@@](=O)(O…
|
| ZINC25757992 ZINC | 0.641 | 346.2 Da LogP -1.40 TPSA 169.0 | ✓ Ro5 | ✓ Clean |
O=c1nc(O)[nH]c2c1ncn2[C@H]1O[C@H]2CO[P@@](=O)(O…
|
| ZINC38581024 ZINC | 0.641 | 346.2 Da LogP -1.40 TPSA 169.0 | ✓ Ro5 | ✓ Clean |
O=c1nc(O)[nH]c2c1ncn2[C@@H]1O[C@@H]2CO[P@](=O)(…
|
| ZINC38580933 ZINC | 0.635 | 329.2 Da LogP -0.82 TPSA 154.8 | ✓ Ro5 | ✓ Clean |
Nc1ncc2ncn([C@@H]3O[C@@H]4CO[P@](=O)(O)O[C@H]4[…
|
| ZINC101148330 ZINC | 0.634 | 445.3 Da LogP 0.81 TPSA 153.2 | ✓ Ro5 | ✓ Clean |
O=c1c2ncn([C@@H]3O[C@@H]4CO[P@](=O)(O)O[C@H]4[C…
|
| ZINC17142115 ZINC | 0.613 | 320.2 Da LogP -1.66 TPSA 172.2 | ✓ Ro5 | ✓ Clean |
NC(=O)c1ncn([C@@H]2O[C@@H]3CO[P@](=O)(O)O[C@@H]…
|
| ZINC22047759 ZINC | 0.613 | 320.2 Da LogP -1.66 TPSA 172.2 | ✓ Ro5 | ✓ Clean |
NC(=O)c1ncn([C@@H]2O[C@@H]3CO[P@](=O)(O)O[C@H]3…
|
| ZINC255997527 ZINC | 0.613 | 320.2 Da LogP -1.66 TPSA 172.2 | ✓ Ro5 | ✓ Clean |
NC(=O)c1ncn([C@@H]2O[C@@H]3CO[P@](=O)(O)O[C@H]3…
|
| ZINC33650193 ZINC | 0.613 | 320.2 Da LogP -1.66 TPSA 172.2 | ✓ Ro5 | ✓ Clean |
NC(=O)c1ncn([C@@H]2O[C@H]3CO[P@](=O)(O)O[C@H]3[…
|
| ZINC33650194 ZINC | 0.613 | 320.2 Da LogP -1.66 TPSA 172.2 | ✓ Ro5 | ✓ Clean |
NC(=O)c1ncn([C@@H]2O[C@@H]3CO[P@](=O)(O)O[C@@H]…
|
| ZINC25757703 ZINC | 0.609 | 330.2 Da LogP -1.11 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
O=c1nc[nH]c2c1ncn2[C@H]1O[C@H]2CO[P@](=O)(O)O[C…
|
| ZINC25757707 ZINC | 0.609 | 330.2 Da LogP -1.11 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
O=c1nc[nH]c2c1ncn2[C@H]1O[C@H]2CO[P@](=O)(O)O[C…
|
| ZINC13516347 ZINC | 0.600 | 353.2 Da LogP -0.15 TPSA 133.2 | ✓ Ro5 | ✓ Clean |
O=[P@]1(O)OC[C@H]2O[C@@H](n3cnc4c3ncn3ccnc43)[C…
|
| ZINC38580945 ZINC | 0.597 | 443.4 Da LogP 0.11 TPSA 192.9 | 1 viol. | ✓ Clean |
NCCCCCCNc1nc(N)c2ncn([C@@H]3O[C@@H]4CO[P@](=O)(…
|
| ZINC4095499 ZINC | 0.571 | 305.2 Da LogP -1.40 TPSA 146.1 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H]3CO[P@](=O)(O)O[C@H]3[C@H]…
|
| ZINC13516498 ZINC | 0.563 | 399.3 Da LogP 0.34 TPSA 157.9 | ✓ Ro5 | ✓ Clean |
CCCC(=O)Nc1ncnc2c1ncn2[C@@H]1O[C@@H]2CO[P@](=O)…
|
| ZINC14948944 ZINC | 0.563 | 399.3 Da LogP 0.34 TPSA 157.9 | ✓ Ro5 | ✓ Clean |
CCCC(=O)Nc1ncnc2c1ncn2[C@@H]1O[C@@H]2CO[P@](=O)…
|
| ZINC256769854 ZINC | 0.563 | 399.3 Da LogP 0.34 TPSA 157.9 | ✓ Ro5 | ✓ Clean |
CCCC(=O)Nc1ncnc2c1ncn2[C@@H]1O[C@@H]2CO[P@](=O)…
|
| ZINC256769855 ZINC | 0.563 | 399.3 Da LogP 0.34 TPSA 157.9 | ✓ Ro5 | ✓ Clean |
CCCC(=O)Nc1ncnc2c1ncn2[C@@H]1O[C@@H]2CO[P@](=O)…
|
| ZINC13829346 ZINC | 0.548 | 433.3 Da LogP 0.85 TPSA 157.9 | ✓ Ro5 | ✓ Clean |
O=C(Nc1ncnc2c1ncn2[C@@H]1O[C@@H]2CO[P@@](=O)(O)…
|
| ZINC31474923 ZINC | 0.548 | 419.3 Da LogP 1.21 TPSA 140.8 | ✓ Ro5 | ✓ Clean |
O=[P@@]1(O)OC[C@H]2O[C@@H](n3cnc4c(NCc5ccccc5)n…
|
| ZINC44559643 ZINC | 0.548 | 433.3 Da LogP 0.85 TPSA 157.9 | ✓ Ro5 | ✓ Clean |
O=C(Nc1ncnc2c1ncn2[C@H]1O[C@H]2CO[P@](=O)(O)O[C…
|
| ZINC4824676 ZINC | 0.545 | 328.2 Da LogP -0.21 TPSA 141.9 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ccn2[C@H]1O[C@H]2CO[P@](=O)(O)O[C@@H]…
|
| ZINC4824677 ZINC | 0.545 | 328.2 Da LogP -0.21 TPSA 141.9 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ccn2[C@@H]1O[C@H]2CO[P@](=O)(O)O[C@@H…
|
| ZINC4824678 ZINC | 0.545 | 328.2 Da LogP -0.21 TPSA 141.9 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ccn2[C@H]1O[C@H]2CO[P@](=O)(O)O[C@@H]…
|
| ZINC4824679 ZINC | 0.545 | 328.2 Da LogP -0.21 TPSA 141.9 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ccn2[C@@H]1O[C@H]2CO[P@](=O)(O)O[C@@H…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.