Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 49.333 Lower values reduce human off-target concern.
- Human E-value
- 2.32e-20
- Gut microbiome similarity
- 1.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 64.678 Higher values support similarity to known essential genes.
- DEG E-value
- 0.0 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 95.9 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MEKLSYASESSTSPWTTYLRQIDRVAPYLGDLAYWVETLRHPKRALIVDIPVQMDDGTIRHFEGYRVQHNLSRGPGKGGVRYHPDVDLNEVMALSAWMTIKCAAVNIPYGGAKGGIRVDPFSLSEGELERLTRRYTSEIGIIIGPQKDIPAPDVGTNGKVMAWMMDTYSMNHGTTITGVVTGKPIHLGGSLGREKATGRGVFVTGREVARRAGIEIEGAKVALQGFGNVGSEAARLFAGVGARIVVIQDHTATLYNEGGIDMAALTAWQAEKKQIAGFPGAQEIDKDAFWTTPMDILIPAALEGQITRERAEKLTCKLVLEGANGPTYPEADDVLAERGVIVVPDVICNAGGVTVSYFEWVQDMASFFWSEEEINAKMDRIMTDAIVHVWDKAAEKECTLRTAAYIVACERILMARKDRGIYPG
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
7- GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
- GO:0006520 The chemical reactions and pathways involving amino acids, carboxylic acids containing one or more amino groups.
- GO:0016639 Catalysis of an oxidation-reduction (redox) reaction in which a CH-NH2 group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
- GO:0004352 Catalysis of the reaction: L-glutamate + NAD+ + H2O = 2-oxoglutarate + NH4+ + NADH + H+.
- GO:0004354 Catalysis of the reaction: L-glutamate + NADP+ + H2O = 2-oxoglutarate + NH4+ + NADPH + H+.
- GO:0000166 Binding to a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
- GO:0006538 The chemical reactions and pathways resulting in the breakdown of L-glutamate.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 9 | 423 | PIRSF | PIRSF000185 | Glu_DH |
| 9 | 423 | InterPro | IPR014362 | Glutamate dehydrogenase |
| 10 | 190 | SUPERFAMILY | SSF53223 | Aminoacid dehydrogenase-like, N-terminal domain |
| 10 | 190 | InterPro | IPR046346 | Aminoacid dehydrogenase-like, N-terminal domain superfamily |
| 188 | 420 | Pfam | PF00208 | Glutamate/Leucine/Phenylalanine/Valine dehydrogenase |
| 188 | 420 | InterPro | IPR006096 | Glutamate/phenylalanine/leucine/valine/L-tryptophan dehydrogenase, C-terminal |
| 188 | 423 | SUPERFAMILY | SSF51735 | NAD(P)-binding Rossmann-fold domains |
| 188 | 423 | InterPro | IPR036291 | NAD(P)-binding domain superfamily |
| 221 | 241 | PRINTS | PR00082 | Glutamate/leucine/phenylalanine/valine dehydrogenase signature |
| 221 | 241 | InterPro | IPR006095 | Glutamate/phenylalanine/leucine/valine/L-tryptophan dehydrogenase |
| 179 | 201 | PRINTS | PR00082 | Glutamate/leucine/phenylalanine/valine dehydrogenase signature |
| 179 | 201 | InterPro | IPR006095 | Glutamate/phenylalanine/leucine/valine/L-tryptophan dehydrogenase |
| 99 | 113 | PRINTS | PR00082 | Glutamate/leucine/phenylalanine/valine dehydrogenase signature |
| 99 | 113 | InterPro | IPR006095 | Glutamate/phenylalanine/leucine/valine/L-tryptophan dehydrogenase |
| 348 | 359 | PRINTS | PR00082 | Glutamate/leucine/phenylalanine/valine dehydrogenase signature |
| 348 | 359 | InterPro | IPR006095 | Glutamate/phenylalanine/leucine/valine/L-tryptophan dehydrogenase |
| 44 | 187 | FunFam | G3DSA:3.40.50.10860:FF:000003 | Glutamate dehydrogenase |
| 195 | 349 | Gene3D | G3DSA:3.40.50.720 | - |
| 107 | 120 | ProSitePatterns | PS00074 | Glu / Leu / Phe / Val dehydrogenases active site. |
| 107 | 120 | InterPro | IPR033524 | Leu/Phe/Val dehydrogenases active site |
| 42 | 170 | Pfam | PF02812 | Glu/Leu/Phe/Val dehydrogenase, dimerisation domain |
| 42 | 170 | InterPro | IPR006097 | Glutamate/phenylalanine/leucine/valine/L-tryptophan dehydrogenase, dimerisation domain |
| 376 | 423 | Gene3D | G3DSA:1.10.8.1210 | - |
| 190 | 420 | SMART | SM00839 | ELFV_dehydrog_3 |
| 190 | 420 | InterPro | IPR006096 | Glutamate/phenylalanine/leucine/valine/L-tryptophan dehydrogenase, C-terminal |
| 12 | 415 | PANTHER | PTHR11606 | GLUTAMATE DEHYDROGENASE |
| 188 | 412 | CDD | cd01076 | NAD_bind_1_Glu_DH |
| 188 | 412 | InterPro | IPR033922 | NAD(P) binding domain of glutamate dehydrogenase |
| 40 | 175 | Gene3D | G3DSA:3.40.50.10860 | Leucine Dehydrogenase, chain A, domain 1 |
| 3 | 350 | Gene3D | G3DSA:1.10.8.1210 | - |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A060VIF0
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_04990
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| AKG RCSB PDB | P00366 | 146.1 Da LogP -0.50 TPSA 91.7 | ✓ Ro5 | ✓ Clean |
C(CC(=O)O)C(=O)C(=O)O
|
|
| B1T RCSB PDB | P00366 | 356.1 Da LogP 5.86 TPSA 40.5 | 1 viol. | ✓ Clean |
c1c(cc(c(c1Sc2cc(cc(c2O)Cl)Cl)O)Cl)Cl
|
|
| GWD RCSB PDB | P00366 | 520.9 Da LogP 5.01 TPSA 49.3 | 2 viol. | ✓ Clean |
c1cc2c(cc1I)/C(=C\c3cc(c(c(c3)Br)O)Br)/C(=O)N2
|
|
| H3P RCSB PDB | P00366 | 406.9 Da LogP 6.61 TPSA 40.5 | 1 viol. | ✓ Clean |
c1c(c(c(c(c1Cl)Cl)Cc2c(c(cc(c2Cl)Cl)Cl)O)O)Cl
|
|
| NH4 RCSB PDB | Q72IC1 | 18.0 Da LogP 0.38 TPSA 36.5 | ✓ Ro5 | ✓ Clean |
[NH4+]
|
|
| XEG RCSB PDB | P00366 | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
c1cc(c(cc1[C@@H]2[C@H](Cc3c(cc(cc3O2)O)O)OC(=O)…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL3400559 ChEMBL | P00366 | — | 817.5 Da LogP 1.07 TPSA 345.0 | 3 viol. | ✓ Clean |
C/C(=C\c1ccc(C2(C(F)(F)F)N=N2)cc1O)C(=O)NCCNP(=…
|
| CHEMBL3400560 ChEMBL | P00366 | — | 737.5 Da LogP 0.96 TPSA 298.5 | 3 viol. | ✓ Clean |
C/C(=C\c1ccc(C2(C(F)(F)F)N=N2)cc1O)C(=O)NCCNP(=…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC3978503 ZINC | 1.000 | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1ccc(O)c(O)…
|
| ZINC4534390 ZINC | 1.000 | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1ccc(O)c(O)c…
|
| ZINC4544252 ZINC | 1.000 | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@H]1c1ccc(O)c(O)c1…
|
| ZINC8681494 ZINC | 1.000 | 442.4 Da LogP 2.53 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@H]1c1ccc(O)c(O)c…
|
| ZINC3870412 ZINC | 0.851 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1cc(O)c(O)c…
|
| ZINC3870413 ZINC | 0.851 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@H]1c1cc(O)c(O)c(…
|
| ZINC3870414 ZINC | 0.851 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1cc(O)c(O)c(…
|
| ZINC3870415 ZINC | 0.851 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@H]1c1cc(O)c(O)c(O…
|
| ZINC14642643 ZINC | 0.849 | 456.4 Da LogP 2.83 TPSA 166.1 | 1 viol. | Alert |
COc1cc(C(=O)O[C@@H]2Cc3c(O)cc(O)cc3O[C@@H]2c2cc…
|
| ZINC14727965 ZINC | 0.837 | 426.4 Da LogP 2.82 TPSA 156.9 | 1 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1ccc(O)cc1)…
|
| ZINC3843497 ZINC | 0.762 | 370.0 Da LogP 4.71 TPSA 80.9 | ✓ Ro5 | ✓ Clean |
Oc1c(Cl)cc(Cl)c(O)c1Cc1c(O)c(Cl)cc(Cl)c1O
|
| ZINC14436185 ZINC | 0.741 | 472.4 Da LogP 2.54 TPSA 186.4 | 2 viol. | Alert |
COc1cc(C(=O)O[C@@H]2Cc3c(O)cc(O)cc3O[C@@H]2c2cc…
|
| ZINC21992193 ZINC | 0.722 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1cc(O)c(O)c…
|
| ZINC21992196 ZINC | 0.722 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@@H]1c1cc(O)c(O)c(…
|
| ZINC21992198 ZINC | 0.722 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@@H]1Cc2c(O)cc(O)cc2O[C@H]1c1cc(O)c(O)c(…
|
| ZINC21992201 ZINC | 0.722 | 458.4 Da LogP 2.23 TPSA 197.4 | 2 viol. | Alert |
O=C(O[C@H]1Cc2c(O)cc(O)cc2O[C@H]1c1cc(O)c(O)c(O…
|
| ZINC1903857763 ZINC | 0.689 | 411.0 Da LogP 4.12 TPSA 69.6 | ✓ Ro5 | Alert |
O=C1Nc2ccc(Br)cc2C1=Cc1cc(O)c(O)c(Br)c1
|
| ZINC2104376 ZINC | 0.689 | 411.0 Da LogP 4.12 TPSA 69.6 | ✓ Ro5 | Alert |
O=C1Nc2ccc(Br)cc2/C1=C/c1cc(O)c(O)c(Br)c1
|
| ZINC96481959 ZINC | 0.689 | 411.0 Da LogP 4.12 TPSA 69.6 | ✓ Ro5 | Alert |
O=C1Nc2ccc(Br)cc2/C1=C\c1cc(O)c(O)c(Br)c1
|
| ZINC14642853 ZINC | 0.632 | 442.4 Da LogP 2.18 TPSA 177.1 | 1 viol. | Alert |
O=C(Oc1cc(O)cc2c1C[C@H](O)[C@@H](c1ccc(O)c(O)c1…
|
| ZINC15016062 ZINC | 0.620 | 425.1 Da LogP 4.42 TPSA 58.6 | ✓ Ro5 | ✓ Clean |
COc1cc(/C=C2\C(=O)Nc3ccc(Br)cc32)cc(Br)c1O
|
| ZINC13610584 ZINC | 0.619 | 498.5 Da LogP 2.89 TPSA 177.1 | 1 viol. | Alert |
O=C(C[C@H](O)CCc1ccc(O)c(O)c1)O[C@@H]1Cc2c(O)cc…
|
| ZINC13610587 ZINC | 0.619 | 498.5 Da LogP 2.89 TPSA 177.1 | 1 viol. | Alert |
O=C(C[C@@H](O)CCc1ccc(O)c(O)c1)O[C@H]1Cc2c(O)cc…
|
| ZINC13610590 ZINC | 0.619 | 498.5 Da LogP 2.89 TPSA 177.1 | 1 viol. | Alert |
O=C(C[C@H](O)CCc1ccc(O)c(O)c1)O[C@H]1Cc2c(O)cc(…
|
| ZINC8652640 ZINC | 0.619 | 498.5 Da LogP 2.89 TPSA 177.1 | 1 viol. | Alert |
O=C(C[C@@H](O)CCc1ccc(O)c(O)c1)O[C@@H]1Cc2c(O)c…
|
| ZINC119978 ZINC | 0.600 | 290.3 Da LogP 1.55 TPSA 110.4 | ✓ Ro5 | Alert |
Oc1cc(O)c2c(c1)O[C@@H](c1ccc(O)c(O)c1)[C@@H](O)…
|
| ZINC119983 ZINC | 0.600 | 290.3 Da LogP 1.55 TPSA 110.4 | ✓ Ro5 | Alert |
Oc1cc(O)c2c(c1)O[C@H](c1ccc(O)c(O)c1)[C@@H](O)C2
|
| ZINC119985 ZINC | 0.600 | 290.3 Da LogP 1.55 TPSA 110.4 | ✓ Ro5 | Alert |
Oc1cc(O)c2c(c1)O[C@@H](c1ccc(O)c(O)c1)[C@H](O)C2
|
| ZINC119988 ZINC | 0.600 | 290.3 Da LogP 1.55 TPSA 110.4 | ✓ Ro5 | Alert |
Oc1cc(O)c2c(c1)O[C@H](c1ccc(O)c(O)c1)[C@H](O)C2
|
| ZINC1569727 ZINC | 0.593 | 202.3 Da LogP -0.05 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)O
|
| ZINC1569728 ZINC | 0.593 | 202.3 Da LogP -0.05 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@@H](C)C(=O)O
|
| ZINC1569729 ZINC | 0.593 | 202.3 Da LogP -0.05 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@H](C)C(=O)O
|
| ZINC1569730 ZINC | 0.593 | 202.3 Da LogP -0.05 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@H](C)C(=O)O
|
| ZINC1560407548 ZINC | 0.586 | 441.4 Da LogP 2.69 TPSA 177.1 | 1 viol. | Alert |
O=C(O[C]1Cc2c(O)cc(O)cc2O[C@@H]1c1ccc(O)c(O)c1)…
|
| ZINC2522597 ZINC | 0.586 | 246.3 Da LogP -0.60 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](NC(=O)C[C@H](N)C(=O)O)C(=O)O
|
| ZINC5567094 ZINC | 0.585 | 390.0 Da LogP 1.67 TPSA 95.5 | ✓ Ro5 | Alert |
O=C1NC(=O)C(=Cc2cc(Br)c(O)c(Br)c2)C(=O)N1
|
| ZINC1532219 ZINC | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)O
|
| ZINC1532220 ZINC | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](NC(=O)[C@H](N)CC(C)C)C(=O)O
|
| ZINC1532221 ZINC | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
|
| ZINC1532222 ZINC | 0.571 | 244.3 Da LogP 0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@H](CC(C)C)C(=O)O
|
| ZINC394419 ZINC | 0.565 | 231.9 Da LogP 4.01 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
Oc1c(Cl)cc(Cl)c(Cl)c1Cl
|
| ZINC15016055 ZINC | 0.560 | 376.2 Da LogP 3.66 TPSA 67.8 | ✓ Ro5 | ✓ Clean |
COc1cc(/C=C2\C(=O)Nc3ccc(Br)cc32)cc(OC)c1O
|
| ZINC59426354 ZINC | 0.558 | 406.1 Da LogP 1.83 TPSA 78.4 | ✓ Ro5 | Alert |
O=C1NC(=S)NC(=O)C1=Cc1cc(Br)c(O)c(Br)c1
|
| ZINC1605717 ZINC | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@H](C(=O)O)C(C)C
|
| ZINC1605718 ZINC | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@H](C(=O)O)C(C)C
|
| ZINC1605719 ZINC | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@H](N)C(=O)N[C@@H](C(=O)O)C(C)C
|
| ZINC1605720 ZINC | 0.552 | 230.3 Da LogP 0.59 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
CC(C)C[C@@H](N)C(=O)N[C@@H](C(=O)O)C(C)C
|
| ZINC249691100 ZINC | 0.548 | 436.4 Da LogP 0.40 TPSA 169.3 | 1 viol. | Alert |
C[C@@H]1O[C@H](O[C@@H]2Cc3c(O)cc(O)cc3O[C@H]2c2…
|
| ZINC250898615 ZINC | 0.548 | 436.4 Da LogP 0.40 TPSA 169.3 | 1 viol. | Alert |
C[C@H]1O[C@H](O[C@H]2Cc3c(O)cc(O)cc3O[C@H]2c2cc…
|
| ZINC38469525 ZINC | 0.548 | 436.4 Da LogP 0.40 TPSA 169.3 | 1 viol. | Alert |
C[C@@H]1O[C@H](O[C@H]2Cc3c(O)cc(O)cc3O[C@@H]2c2…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.