Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 47.083 Lower values reduce human off-target concern.
- Human E-value
- 2.950000000000001e-59
- Gut microbiome similarity
- 2.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 47.525 Higher values support similarity to known essential genes.
- DEG E-value
- 3.66e-107 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 98.01 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MRDAFICDGIRTPIGRYGGALASVRADDLAAIPLRELLSRNPGLDPAAIDDVIFGCANQAGEDNRNVAHMATLLAGYPYTVPGTTINRLCGSGLDAIGFAARAIKAGDAELLIAGGVESMSRAPFVMGKASAPYQRQAELFDTTIGWRFVNPLMAQHFGTDSMPETAENVAELLNISRADQDAFAWRSQQRTAQAQRDGILAQEIVPVQIVGRKGAVSDVREDEHPRPETTLEQLAKLKAPFRQGGVITAGNASGVNDGAAALIIASEQQAAIQGLTPRARIVAMATAGVEPRLMGLGPVPAVRKVLERAGLNINDMDLIELNEAFAAQALGVLRQLGVPDDAAHVNPNGGAIALGHPLGMSGARLALSASLELQRRGGRYALCTMCIGVGQGIAMILERV
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
4- GO:0019619 The chemical reactions and pathways resulting in the breakdown of 3,4-dihydroxybenzoate.
- GO:0016746 Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
- GO:0016747 Catalysis of the transfer of an acyl group, other than amino-acyl, from one compound (donor) to another (acceptor).
- GO:0033812 Catalysis of the reaction: succinyl-CoA + acetyl-CoA = CoA + 3-oxoadipyl-CoA.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 401 | Gene3D | G3DSA:3.40.47.10 | - |
| 1 | 401 | InterPro | IPR016039 | Thiolase-like |
| 2 | 401 | PANTHER | PTHR18919 | ACETYL-COA C-ACYLTRANSFERASE |
| 2 | 401 | NCBIfam | TIGR02430 | 3-oxoadipyl-CoA thiolase |
| 2 | 401 | InterPro | IPR012793 | Beta-ketoadipyl CoA thiolase |
| 1 | 401 | PIRSF | PIRSF000429 | Ac-CoA_Ac_transf |
| 1 | 401 | InterPro | IPR002155 | Thiolase |
| 382 | 395 | ProSitePatterns | PS00099 | Thiolases active site. |
| 382 | 395 | InterPro | IPR020610 | Thiolase, active site |
| 3 | 272 | SUPERFAMILY | SSF53901 | Thiolase-like |
| 3 | 272 | InterPro | IPR016039 | Thiolase-like |
| 347 | 363 | ProSitePatterns | PS00737 | Thiolases signature 2. |
| 347 | 363 | InterPro | IPR020613 | Thiolase, conserved site |
| 5 | 269 | Pfam | PF00108 | Thiolase, N-terminal domain |
| 5 | 269 | InterPro | IPR020616 | Thiolase, N-terminal |
| 86 | 104 | ProSitePatterns | PS00098 | Thiolases acyl-enzyme intermediate signature. |
| 86 | 104 | InterPro | IPR020615 | Thiolase, acyl-enzyme intermediate active site |
| 5 | 400 | CDD | cd00751 | thiolase |
| 5 | 400 | InterPro | IPR002155 | Thiolase |
| 277 | 400 | Pfam | PF02803 | Thiolase, C-terminal domain |
| 277 | 400 | InterPro | IPR020617 | Thiolase, C-terminal |
| 6 | 399 | NCBIfam | TIGR01930 | acetyl-CoA C-acyltransferase |
| 6 | 399 | InterPro | IPR002155 | Thiolase |
| 1 | 400 | FunFam | G3DSA:3.40.47.10:FF:000010 | Acetyl-CoA acetyltransferase (Thiolase) |
| 277 | 400 | SUPERFAMILY | SSF53901 | Thiolase-like |
| 277 | 400 | InterPro | IPR016039 | Thiolase-like |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GSN7
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_04976
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 168 RCSB PDB | P07097 | 388.5 Da LogP 0.15 TPSA 131.0 | ✓ Ro5 | ✓ Clean |
CC(=O)OCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COC(=O)C(C…
|
|
| 3G6 RCSB PDB | I6XHI4 | 344.5 Da LogP 4.86 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@@H]([C@H]1CC[C@@H]2[C@@]1(CC[C@H]3[C@H]2CCC…
|
|
| 5UG RCSB PDB | P76461 | 438.3 Da LogP -0.85 TPSA 191.7 | 1 viol. | ✓ Clean |
CC(C)(COP(=O)(O)OP(=O)(O)O)[C@@H](C(=O)NCCC(=O)…
|
|
| CAA RCSB PDB | P07097 | 851.6 Da LogP -1.36 TPSA 380.7 | 3 viol. | ✓ Clean |
CC(=O)CC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P…
|
|
| COZ RCSB PDB | P76461 | 767.5 Da LogP -1.67 TPSA 346.6 | 3 viol. | ✓ Clean |
CC(C)(CO[P@](=O)(O)O[P@](=O)(O)OC[C@@H]1[C@H]([…
|
|
| DNO RCSB PDB | P07097 | 180.2 Da LogP -3.38 TPSA 118.2 | ✓ Ro5 | ✓ Clean |
C([C@H]([C@H]([C@@H]([C@@H](C=O)O)O)O)O)O
|
|
| DTT RCSB PDB | P42765 | 154.3 Da LogP -0.43 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
C([C@@H]([C@H](CS)O)O)S
|
|
| O8Y RCSB PDB | Q88N39 | 100.2 Da LogP 1.77 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CCCCCC=O
|
|
| OPI RCSB PDB | P07097 | 346.4 Da LogP -0.42 TPSA 125.0 | ✓ Ro5 | ✓ Clean |
CC(C)(C)C(=O)OCC(C)(C)[C@H](C(=O)NCCC(=O)NCCO)O
|
|
| OYA RCSB PDB | Q88N39 | 128.2 Da LogP 2.55 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCC=O
|
|
| PN5 RCSB PDB | P07097 | 362.5 Da LogP 0.52 TPSA 104.7 | ✓ Ro5 | ✓ Clean |
CC(C)(C)C(=O)OCC(C)(C)[C@H](C(=O)NCCC(=O)NCCS)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC4403984 ZINC | 1.000 | 344.5 Da LogP 4.86 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@@H](C(=O)O)[C@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)…
|
| ZINC5763280 ZINC | 1.000 | 344.5 Da LogP 4.86 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@H](C(=O)O)[C@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)C…
|
| ZINC100056793 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)CO
|
| ZINC100056796 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@H](O)CO
|
| ZINC12953159 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@H](O)[C@H](O)[C@@H](O)CO
|
| ZINC12953162 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO
|
| ZINC12953168 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)CO
|
| ZINC13522675 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@H](O)[C@H](O)[C@H](O)CO
|
| ZINC13522684 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)CO
|
| ZINC4353166 ZINC | 0.950 | 240.2 Da LogP -4.66 TPSA 158.7 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O…
|
| ZINC4353167 ZINC | 0.950 | 240.2 Da LogP -4.66 TPSA 158.7 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O…
|
| ZINC4353168 ZINC | 0.950 | 240.2 Da LogP -4.66 TPSA 158.7 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)…
|
| ZINC4353169 ZINC | 0.950 | 240.2 Da LogP -4.66 TPSA 158.7 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)…
|
| ZINC4353180 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O…
|
| ZINC4353181 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)…
|
| ZINC4353182 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)…
|
| ZINC95884213 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)CO
|
| ZINC9915770 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO
|
| ZINC9915771 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO
|
| ZINC1693894 ZINC | 0.938 | 212.4 Da LogP 4.89 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC=O
|
| ZINC13542964 ZINC | 0.796 | 316.5 Da LogP 4.52 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@@H](O)[C@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[C@…
|
| ZINC253497962 ZINC | 0.796 | 316.5 Da LogP 4.52 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@@H](O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C…
|
| ZINC253497963 ZINC | 0.796 | 316.5 Da LogP 4.52 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@H](O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C@…
|
| ZINC2539736 ZINC | 0.796 | 316.5 Da LogP 4.52 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@@H](O)[C@@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[C…
|
| ZINC36323232 ZINC | 0.796 | 316.5 Da LogP 4.52 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@@H](O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C…
|
| ZINC3875971 ZINC | 0.796 | 316.5 Da LogP 4.52 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@H](O)[C@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[C@]…
|
| ZINC4096295 ZINC | 0.796 | 316.5 Da LogP 4.52 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@H](O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C@…
|
| ZINC968170 ZINC | 0.796 | 316.5 Da LogP 4.52 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@H](O)[C@@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[C@…
|
| ZINC43061660 ZINC | 0.789 | 210.4 Da LogP 4.66 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCC=O
|
| ZINC43061664 ZINC | 0.789 | 210.4 Da LogP 4.66 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C/CCCCCC=O
|
| ZINC13540558 ZINC | 0.750 | 330.5 Da LogP 4.76 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@H](CO)[C@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[C@…
|
| ZINC1848438168 ZINC | 0.750 | 330.5 Da LogP 4.76 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@H](CO)[C@H]1CC[C@@H]2[C@@H]3CCC4=CC(=O)CC[C…
|
| ZINC1848438169 ZINC | 0.750 | 330.5 Da LogP 4.76 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@@H](CO)[C@H]1CC[C@@H]2[C@@H]3CCC4=CC(=O)CC[…
|
| ZINC256518048 ZINC | 0.750 | 330.5 Da LogP 4.76 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@H](CO)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C…
|
| ZINC257359313 ZINC | 0.750 | 330.5 Da LogP 4.76 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@H](CO)[C@@H]1CC[C@@H]2[C@@H]3CCC4=CC(=O)CC[…
|
| ZINC257359314 ZINC | 0.750 | 330.5 Da LogP 4.76 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@H](CO)[C@@H]1CC[C@@H]2[C@@H]3CCC4=CC(=O)CC[…
|
| ZINC257359315 ZINC | 0.750 | 330.5 Da LogP 4.76 TPSA 37.3 | ✓ Ro5 | ✓ Clean |
C[C@H](CO)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[C…
|
| ZINC13759936 ZINC | 0.731 | 328.5 Da LogP 4.97 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](C=O)[C@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[…
|
| ZINC1700147 ZINC | 0.731 | 328.5 Da LogP 4.97 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@H](C=O)[C@@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[…
|
| ZINC2042904 ZINC | 0.731 | 328.5 Da LogP 4.97 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](C=O)[C@@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC…
|
| ZINC255004289 ZINC | 0.731 | 328.5 Da LogP 4.97 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@H](C=O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[…
|
| ZINC255004290 ZINC | 0.731 | 328.5 Da LogP 4.97 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](C=O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC…
|
| ZINC255004291 ZINC | 0.731 | 328.5 Da LogP 4.97 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@H](C=O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC[…
|
| ZINC36323209 ZINC | 0.731 | 328.5 Da LogP 4.97 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](C=O)[C@@H]1CC[C@@H]2[C@H]3CCC4=CC(=O)CC…
|
| ZINC4416476 ZINC | 0.731 | 328.5 Da LogP 4.97 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C[C@H](C=O)[C@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[C…
|
| ZINC245224552 ZINC | 0.706 | 316.4 Da LogP 4.22 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@@H]3[C@H](CCC4=CC(=O)CC[C@@]43C)[C@…
|
| ZINC253618174 ZINC | 0.706 | 316.4 Da LogP 4.22 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@@]12CCC(=O)C=C1CC[C@H]1[C@H]2CC[C@]2(C)[C@H…
|
| ZINC253648944 ZINC | 0.706 | 316.4 Da LogP 4.22 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](CCC4=CC(=O)CC[C@@]43C)[C@…
|
| ZINC32911458 ZINC | 0.706 | 316.4 Da LogP 4.22 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](CCC4=CC(=O)CC[C@@]43C)[C@…
|
| ZINC3927796 ZINC | 0.706 | 316.4 Da LogP 4.22 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
C[C@]12CC[C@H]3[C@@H](CCC4=CC(=O)CC[C@@]43C)[C@…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.