KpKP13 Protein target profile

hypothetical protein

Accession: KP13_04365

Gene: AHE44903.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GWK1
Length 289
Pocket druggability (P2Rank · AlphaFold DB model) 0.691
Direct ligand evidence 0 106 total records
Functional annotation 0 EC 2 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
92.74 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.691
Structure A0A0H3GWK1
Pocket Pocket 1
Druggability (FPocket) 0.754
Structure A0A0H3GWK1
Pocket Pocket 4
ColabFold model
P2Rank 0.789 · Pocket 1
FPocket 0.303 · Pocket 1
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 5 / 4744 genomes with a hit
Prevalence 0.1%

Sequence

Primary amino-acid sequence viewer.

MMQTYQTGDSLIFKVPEREISLQPAALYPEAFPVAEAEAVIQPIALSIHSWVVQTPHDLIVIDTATGNGRERGGNPLYHQLNTPYLENLRAAGVNPEDVTLVLLTHLHTDHVGWNTVWQDDRWVPLFPNARYLCSAKELSRVKNSERYRALWLDSLLPVIEAGQLETVDVATRPRVGGRIDFIPTPGHSPDHAALVLAAGDVYVCFSGDLLHSPIQFAHPQWNSAFCGDPRQAEVSRREMMAWGASHHAQWFTGHFAGPSCGWLEKDKQGDYRWREAGKQAADKGNSDE

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

2
  • GO:0016787 Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc.
  • GO:0046872 Binding to a metal ion.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

10 records
Show feature table
Start End DB Term Name
47 247 SMART SM00849 Lactamase_B_5a
47 247 InterPro IPR001279 Metallo-beta-lactamase
1 280 Gene3D G3DSA:3.60.15.10 -
1 280 InterPro IPR036866 Ribonuclease Z/Hydroxyacylglutathione hydrolase-like
38 255 CDD cd16277 metallo-hydrolase-like_MBL-fold
47 238 Pfam PF00753 Metallo-beta-lactamase superfamily
47 238 InterPro IPR001279 Metallo-beta-lactamase
43 260 PANTHER PTHR42978 QUORUM-QUENCHING LACTONASE YTNP-RELATED-RELATED
44 266 SUPERFAMILY SSF56281 Metallo-hydrolase/oxidoreductase
44 266 InterPro IPR036866 Ribonuclease Z/Hydroxyacylglutathione hydrolase-like

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.691
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.011
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #4
0.754
Show in viewer
Surrounding area
Pocket 2 FPocket #6
0.449
Show in viewer
Surrounding area
Pocket 3 FPocket #1
0.438
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GWK1
AlphaFold DB full sequence Viewing
ColabFold KP13_04365
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

106 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 56 records from similar proteins
Structural ligands 19 0 loaded crystals
Measured bioactivity 37 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
3C7 PDB via homolog 237.4 Da · LogP 0.82 · TPSA 40.5 Open detail RCSB PDB
3P7 PDB via homolog Detail RCSB PDB
3R9 PDB via homolog Detail RCSB PDB
60M PDB via homolog Detail RCSB PDB
60N PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
3C7 RCSB PDB P52700 237.4 Da LogP 0.82 TPSA 40.5 ✓ Ro5 ✓ Clean C1[C@H](N2[C@@H](S1)CS[C@@H]2CS)C(=O)O
3P7 RCSB PDB B2FTM1 406.3 Da LogP -0.34 TPSA 171.8 ✓ Ro5 ✓ Clean CO[C@@](C=O)([C@@H]1N=C(C(=C)CO1)C(=O)O)NC(=O)[…
3R9 RCSB PDB P52700 237.4 Da LogP 0.82 TPSA 40.5 ✓ Ro5 ✓ Clean C1[C@@H](N2[C@H](S1)CS[C@H]2CS)C(=O)O
60M RCSB PDB P52700 217.1 Da LogP 0.46 TPSA 107.7 ✓ Ro5 ✓ Clean c1cc(nc(c1)C(=O)O)CP(=O)(O)O
60N RCSB PDB P52700 233.1 Da LogP -0.05 TPSA 128.0 ✓ Ro5 ✓ Clean c1cc(nc(c1)C(=O)O)[C@@H](O)P(=O)(O)O
C6L RCSB PDB I7HB71 217.3 Da LogP 0.52 TPSA 86.6 ✓ Ro5 ✓ Clean CCCCCC(=O)N[C@@H](CCO)C(=O)O
HIW RCSB PDB B2FTM1 317.4 Da LogP -0.34 TPSA 143.1 ✓ Ro5 ✓ Clean [H]/N=C\NCCS[C@H]1C[C@@H](N=C1C(=O)O)[C@@H]([C@…
I38 RCSB PDB P52700 177.2 Da LogP -0.10 TPSA 66.4 ✓ Ro5 ✓ Clean C[C@H](C(=O)O)NC(=O)CCS
L13 RCSB PDB P52700 206.3 Da LogP 1.63 TPSA 59.6 ✓ Ro5 ✓ Clean Cc1ccccc1C2=NNC(=S)N2N
L3B RCSB PDB P52700 189.2 Da LogP 2.49 TPSA 37.1 ✓ Ro5 ✓ Clean Cc1ccccc1C2=NC(=S)N=N2
LMP RCSB PDB B2FTM1 401.5 Da LogP -0.47 TPSA 139.5 ✓ Ro5 ✓ Clean C[C@H]1[C@@H](C(=N[C@H]1[C@@H]([C@@H](C)O)C(=O)…
MCO RCSB PDB P52700 217.3 Da LogP 0.63 TPSA 57.6 ✓ Ro5 ✓ Clean C[C@H](CS)C(=O)N1CCC[C@@H]1C(=O)O
MP2 RCSB PDB P52700 312.3 Da LogP 0.41 TPSA 104.7 ✓ Ro5 ✓ Clean c1ccc(cc1)COC(=O)N[C@@H](CS)C(=O)NCC(=O)O
MX1 RCSB PDB P52700 422.3 Da LogP -0.46 TPSA 192.0 ✓ Ro5 ✓ Clean CO[C@]([C@@H]1N=C(C(=C)CO1)C(=O)O)(C(=O)O)NC(=O…
PHN RCSB PDB P52700 180.2 Da LogP 2.78 TPSA 25.8 ✓ Ro5 ✓ Clean c1cc2ccc3cccnc3c2nc1
VC2 RCSB PDB P52700 265.4 Da LogP 1.60 TPSA 40.5 ✓ Ro5 ✓ Clean CC1([C@@H](N2[C@H](S1)CS[C@H]2CS)C(=O)O)C
VI RCSB PDB P52700 308.3 Da LogP 2.94 TPSA 92.4 ✓ Ro5 ✓ Clean c1ccc(cc1)c2c(c(n(n2)c3ccccc3)C(=O)O)C(=O)O
VII RCSB PDB P52700 308.3 Da LogP 4.01 TPSA 87.7 ✓ Ro5 ✓ Clean c1ccc(cc1)c2c(c(c(o2)c3ccccc3)C(=O)O)C(=O)O
X8Z RCSB PDB B2FTM1 217.3 Da LogP 0.63 TPSA 57.6 ✓ Ro5 ✓ Clean C[C@H](CS)C(=O)N1CCC[C@H]1C(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.